RASSF8 Antibody

Images

 
Orthogonal Strategies: Western Blot: RASSF8 Antibody [NBP1-88388] - Analysis in human cell lines PC-3 and A-549 using anti-RASSF8 antibody. Corresponding RASSF8 RNA-seq data are presented for the same cell lines. ...read more
Immunocytochemistry/ Immunofluorescence: RASSF8 Antibody [NBP1-88388] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol & mitochondria.
Immunohistochemistry-Paraffin: RASSF8 Antibody [NBP1-88388] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.
Western Blot: RASSF8 Antibody [NBP1-88388] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

RASSF8 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: KQLKDQLQEIRQKITECENKLKDYLAQIRTMESGLEAEKLQREVQEAQVNEEEVKGKIGKVKGEIDIQGQQSLRLENGIKAVERSLGQATKRLQDKEQE
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RASSF8
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RASSF8 Protein (NBP1-88388PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (87%), Rat (84%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RASSF8 Antibody

  • C12orf2
  • carcinoma associated HOJ-1
  • Carcinoma-associated protein HOJ-1
  • chromosome 12 open reading frame 2
  • DKFZp434O0227
  • FLJ11542
  • HOJ1
  • HoJ-1
  • Ras association (RalGDS/AF-6) domain family (N-terminal) member 8
  • ras association domain-containing protein 8

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80938
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-84725
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-88128
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-03644
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
AF748
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
NBP1-54467
Species: Ch, Av-Du, Hu, Mu, Pm, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
NBP2-15723
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-29661
Species: Hu, Mu, Rt
Applications: ELISA
NBP2-02665
Species: Ca, Hu, Pm, Po, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB300-221
Species: Av, Bv, Ca, Ch, ChHa, Dr, Eq, Fe, Ha, Hu, Mu, Ma-Op, Po, Pm, Rb, Rt, Sh, Ze
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IP, KD, Simple Western, Single-Cell Western, WB
NBP2-67599
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP3-05039
Species: Hu, Mu, Rt
Applications: IHC, WB
NBP1-19613
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, Simple Western, WB
NBP1-82458
Species: Hu
Applications: IHC, IHC-P
AF2685
Species: Hu
Applications: IHC, Simple Western, WB
AF2377
Species: Mu
Applications: IHC, Simple Western, WB
NBP2-29323
Species: Bv, Ca, Ch, Hu, Mu, Rt, Xp
Applications: Func-Inh
NBP1-88388
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for RASSF8 Antibody (NBP1-88388) (0)

There are no publications for RASSF8 Antibody (NBP1-88388).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RASSF8 Antibody (NBP1-88388) (0)

There are no reviews for RASSF8 Antibody (NBP1-88388). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RASSF8 Antibody (NBP1-88388) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RASSF8 Products

Bioinformatics Tool for RASSF8 Antibody (NBP1-88388)

Discover related pathways, diseases and genes to RASSF8 Antibody (NBP1-88388). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RASSF8 Antibody (NBP1-88388)

Discover more about diseases related to RASSF8 Antibody (NBP1-88388).
 

Pathways for RASSF8 Antibody (NBP1-88388)

View related products by pathway.

PTMs for RASSF8 Antibody (NBP1-88388)

Learn more about PTMs related to RASSF8 Antibody (NBP1-88388).

Blogs on RASSF8

There are no specific blogs for RASSF8, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RASSF8 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RASSF8