PAMCI Antibody - BSA Free

Western Blot: PAMCI Antibody [NBP1-80938] - Analysis using Anti-RASSF9 antibody NBP1-80938 (A) shows similar pattern to independent antibody NBP1-80937 (B).

Western Blot: PAMCI Antibody [NBP1-80938] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Staining of human skin shows moderate cytoplasmic positivity in squamous epithelial cells.

Staining of human small intestine shows strong cytoplasmic positivity in glandular cells.

Staining of human breast shows strong membranous positivity in glandular cells.

Staining of human lymph node shows no positivity in non-germinal center cells as expected.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PAMCI Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit PAMCI Antibody - BSA Free (NBP1-80938) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: YELLAKEFNSLHISNKDGCQLKENRAKESEVPSSNGEIPPFTQRVFSNYTNDTDSDTGISSNHSQDSETTVGDVVLLST
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RASSF9
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  PAMCI Protein (NBP1-80938PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for PAMCI Antibody - BSA Free

• PAM COOH-terminal interactor protein 1
• PAMCI
• PCIP1
• P-CIP1peptidylglycine alpha-amidating monooxygenase COOH-terminal interactorprotein-1
• Peptidylglycine alpha-amidating monooxygenase COOH-terminal interactor
• Ras association (RalGDS/AF-6) domain family (N-terminal) member 9
• ras association domain-containing protein 9

Background

The protein encoded by the PAMCI gene localizes to perinuclear endosomes. This protein associates with peptidylglycine alpha-amidating monooxygenase, and may be involved with the trafficking of this enzyme through secretory or endosomal pathways. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RASSF9
• Entrez:
  • 9182(Human)
• Uniprot:
  • O75901(Human)