RASGRP3 Antibody [DyLight 350]

• Reactivity: Hu, Mu
• Applications: WB, ELISA, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: DyLight 350

RASGRP3 Antibody [DyLight 350] Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 540-689 of human RASGRP3 (NP_056191.1).
  
  Sequence:
  VLACRRFARAPSLSSGHGSLPGSPSLPPAQDEVFEFPGVTAGHRDLDSRAITLVTGSSRKISVRLQRATTSQATQTEPVWSEAGWGDSGSHTFPKMKSKFHDKAAKDKGFAKWENEKPRVHAGVDVVDRGTEFELDQDEGEETRQDGEDG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RASGRP3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot
• Application Notes: Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

• Storage: Store at 4C in the dark.
• Buffer: 50mM Sodium Borate
• Preservative: 0.05% Sodium Azide
• Purity: Affinity purified

Notes

DyLight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries.

Alternate Names for RASGRP3 Antibody [DyLight 350]

• Calcium and DAG-regulated guanine nucleotide exchange factor III
• GRP3KIAA0846ras guanyl-releasing protein 3
• Guanine nucleotide exchange factor for Rap1
• RAS guanyl releasing protein 3 (calcium and DAG-regulated)

Background

Members of the RAS (see HRAS; MIM 190020) subfamily of GTPases function in signal transduction as GTP/GDP-regulated switches that cycle between inactive GDP- and active GTP-bound states. Guanine nucleotide exchange factors (GEFs), such as RASGRP3, serve as RAS activators by promoting acquisition of GTP to maintain the active GTP-bound state and are the key link between cell surface receptors and RAS activation (Rebhun et al., 2000 [PubMed 10934204]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RASGRP3