RAPGEF2 Antibody - BSA Free

Western Blot: RAPGEF2 Antibody [NBP2-88124] - Host: Rabbit. Target Name: Rapgef2. Sample Type: Mouse Brain lysates. Antibody Dilution: 1.0ug/ml

Immunohistochemistry-Paraffin: RAPGEF2 Antibody [NBP2-88124] - Rabbit Anti-RAPGEF2 antibody. Formalin Fixed Paraffin Embedded Tissue: Human Small Intestine. Primary antibody Concentration: 1:100. Secondary Antibody: Donkey anti-Rabbit-Cy3. Secondary Antibody Concentration: 1:200.

Immunohistochemistry-Paraffin: RAPGEF2 Antibody [NBP2-88124] - Rabbit Anti-RAPGEF2 antibody. Formalin Fixed Paraffin Embedded Tissue: Human Adrenal. Primary antibody Concentration: 1:100. Secondary Antibody: Donkey anti-Rabbit-Cy3. Secondary Antibody Concentration: 1:200. Magnification: 20x.

• Reactivity: Hu, Mu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

RAPGEF2 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of mouse RAPGEF2. Peptide sequence: GHTHFDYSGDAASIWASGGHMDQMMFSDHSTKYNRQNQSRESLEQAQSRA The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RAPGEF2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for RAPGEF2 Antibody - BSA Free

• CNrasGEF
• KIAA0313
• Neural RAP guanine nucleotide exchange protein
• nRap GEP
• NRAPGEP
• PDZ domain containing guanine nucleotide exchange factor (GEF) 1
• PDZGEF1
• PDZ-GEF1PDZ domain-containing guanine nucleotide exchange factor 1
• RA(Ras/Rap1A-associating)-GEF
• RA-GEFDKFZP586O1422
• Rap guanine nucleotide exchange factor (GEF) 2
• rap guanine nucleotide exchange factor 2
• Rap-GEP

Background

Members of the RAS (see HRAS; MIM 190020) subfamily of GTPases function in signal transduction as GTP/GDP-regulated switches that cycle between inactive GDP- and active GTP-bound states. Guanine nucleotide exchange factors (GEFs), such as RAPGEF2, serve as RAS activators by promoting acquisition of GTP to maintain the active GTP-bound state and are the key link between cell surface receptors and RAS activation (Rebhun et al., 2000 [PubMed 10934204]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for RAPGEF2 Antibody (NBP2-88124)(1)

Publication using NBP2-88124

• Wu Q, Hu Y, Ma Q et al. Comprehensive Analysis of RAPGEF2 for Predicting Prognosis and Immunotherapy Response in Patients with Hepatocellular Carcinoma Journal of Oncology 2022-04-26 [PMID: 35518785] (WB)

Bioinformatics

• Gene Symbol: RAPGEF2