RASGRP3 Antibody [mFluor Violet 500 SE]

• Reactivity: Hu, Mu
• Applications: WB, ELISA, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: mFluor Violet 500 SE

RASGRP3 Antibody [mFluor Violet 500 SE] Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 540-689 of human RASGRP3 (NP_056191.1).
  
  Sequence:
  VLACRRFARAPSLSSGHGSLPGSPSLPPAQDEVFEFPGVTAGHRDLDSRAITLVTGSSRKISVRLQRATTSQATQTEPVWSEAGWGDSGSHTFPKMKSKFHDKAAKDKGFAKWENEKPRVHAGVDVVDRGTEFELDQDEGEETRQDGEDG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RASGRP3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot
• Application Notes: Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

• Storage: Store at 4C in the dark.
• Buffer: 50mM Sodium Borate
• Preservative: 0.05% Sodium Azide
• Purity: Affinity purified

Notes

mFluor(TM) is a trademark of AAT Bioquest, Inc. This conjugate is made on demand. Actual recovery may vary from the stated volume of this product. The volume will be greater than or equal to the unit size stated on the datasheet.

Alternate Names for RASGRP3 Antibody [mFluor Violet 500 SE]

• Calcium and DAG-regulated guanine nucleotide exchange factor III
• GRP3KIAA0846ras guanyl-releasing protein 3
• Guanine nucleotide exchange factor for Rap1
• RAS guanyl releasing protein 3 (calcium and DAG-regulated)

Background

Members of the RAS (see HRAS; MIM 190020) subfamily of GTPases function in signal transduction as GTP/GDP-regulated switches that cycle between inactive GDP- and active GTP-bound states. Guanine nucleotide exchange factors (GEFs), such as RASGRP3, serve as RAS activators by promoting acquisition of GTP to maintain the active GTP-bound state and are the key link between cell surface receptors and RAS activation (Rebhun et al., 2000 [PubMed 10934204]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RASGRP3