Rasgrp1 Antibody

Images

 
Western Blot: Rasgrp1 Antibody [NBP1-98413] - Host: Rabbit. Target Name: RASGRP1. Sample Tissue: Human HCT116 Whole Cell. Antibody Dilution: 3ug/ml
Western Blot: Rasgrp1 Antibody [NBP1-98413] - Jurkat Cell Lysate 1.0ug/ml, Gel Concentration: 6-18%

Product Details

Summary
Reactivity Hu, Rt, Ca, Eq, GpSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Rasgrp1 Antibody Summary

Immunogen
The immunogen for this antibody is RASGRP1 - C-terminal region. Peptide sequence LGAKDLLHAPEEGPFTFPNGEAVEHGEESKDRTIMLMGVSSQKISLRLKR. The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Rat (93%), Canine (93%), Equine (93%), Guinea Pig (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RASGRP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
Theoretical MW
90 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Rasgrp1 Antibody

  • RAS guanyl-releasing protein 1
  • CALDAG-GEFI
  • CALDAG-GEFII
  • hRasGRP1
  • RAS guanyl releasing protein 1 (calcium and DAG-regulated)
  • RASGRP

Background

This gene is a member of a family of genes characterized by the presence of a Ras superfamily guanine nucleotide exchange factor (GEF) domain. It functions as a diacylglycerol (DAG)-regulated nucleotide exchange factor specifically activating Ras through the exchange of bound GDP for GTP. It activates the Erk/MAP kinase cascade and regulates T-cells and B-cells development, homeostasis and differentiation. Alternatively spliced transcript variants encoding different isoforms have been identified. Altered expression of the different isoforms of this protein may be a cause of susceptibility to systemic lupus erythematosus (SLE).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1230
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC, KO
NBP2-22203
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-14868
Species: Hu, Mu, Eq
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-95233
Species: Hu, Mu
Applications: WB, ICC/IF, IHC
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NB110-68800
Species: Hu, Mu
Applications: WB, ICC/IF
AF6260
Species: Hu
Applications: WB
NBP2-22527
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP, PLA
NB100-292
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-49938
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP2-45528
Species: Hu
Applications: WB, IHC
NBP2-82026
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-33315
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP2-42864
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-21577
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD
H00056731-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-75641
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-89334
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Rasgrp1 Antibody (NBP1-98413) (0)

There are no publications for Rasgrp1 Antibody (NBP1-98413).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Rasgrp1 Antibody (NBP1-98413) (0)

There are no reviews for Rasgrp1 Antibody (NBP1-98413). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Rasgrp1 Antibody (NBP1-98413) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Rasgrp1 Products

Bioinformatics Tool for Rasgrp1 Antibody (NBP1-98413)

Discover related pathways, diseases and genes to Rasgrp1 Antibody (NBP1-98413). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Rasgrp1 Antibody (NBP1-98413)

Discover more about diseases related to Rasgrp1 Antibody (NBP1-98413).
 

Pathways for Rasgrp1 Antibody (NBP1-98413)

View related products by pathway.

PTMs for Rasgrp1 Antibody (NBP1-98413)

Learn more about PTMs related to Rasgrp1 Antibody (NBP1-98413).
 

Research Areas for Rasgrp1 Antibody (NBP1-98413)

Find related products by research area.

Blogs on Rasgrp1

There are no specific blogs for Rasgrp1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Rasgrp1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RASGRP1
Uniprot