RAP80 Antibody

Images

 
Western Blot: RAP80 Antibody [NBP1-87157] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunocytochemistry/ Immunofluorescence: RAP80 Antibody [NBP1-87157] - Staining of human cell line U-2 OS shows localization to nuclear bodies.
Immunohistochemistry-Paraffin: RAP80 Antibody [NBP1-87157] - Staining of human testis shows strong nuclear positivity in seminiferus tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RAP80 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PVFENVNVKSFDRCTGHSAEHTQCGKPQESTGRGSAFLKAVQGSGDTSRHCLPTLADAKGLQDTGGTVNYFWGIPFCPDGVDPNQYTKVILCQLE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
UIMC1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:10-1:20
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RAP80 Protein (NBP1-87157PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (84%), Rat (81%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RAP80 Antibody

  • BRCA1-A complex subunit RAP80
  • RAP80
  • RAP80X2HRIP110
  • receptor associated protein 80
  • Receptor-associated protein 80
  • retinoid x receptor interacting protein
  • Retinoid X receptor-interacting protein 110
  • RXRIP110
  • ubiquitin interaction motif containing 1
  • Ubiquitin interaction motif-containing protein 1
  • UIMC1
  • X2HRIP110

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-598
Species: Hu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
NBP2-38356
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-76831
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF6604
Species: Hu
Applications: WB, IHC
NB100-304
Species: Hu, Mu, Rt, Fi, Gt, Pm
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KO
H00009025-B01P
Species: Hu
Applications: WB, ICC/IF
NBP1-33038
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-319
Species: Hu
Applications: WB, IP, PLA
NB100-79810
Species: Hu, Mu
Applications: WB, ICC/IF, IP, PLA
NB100-56357
Species: Hu
Applications: WB, IP
NB100-416
Species: Hu, Mu
Applications: WB, IB, ICC/IF, IHC, IHC-P, IP
AF2396
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-56444
Species: Hu
Applications: WB, ICC/IF, IHC-P
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-56346
Species: Hu, Mu
Applications: WB, ELISA, IHC-P
NBP1-58095
Species: Hu
Applications: WB
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP1-87157
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for RAP80 Antibody (NBP1-87157) (0)

There are no publications for RAP80 Antibody (NBP1-87157).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RAP80 Antibody (NBP1-87157) (0)

There are no reviews for RAP80 Antibody (NBP1-87157). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RAP80 Antibody (NBP1-87157) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RAP80 Products

Bioinformatics Tool for RAP80 Antibody (NBP1-87157)

Discover related pathways, diseases and genes to RAP80 Antibody (NBP1-87157). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RAP80 Antibody (NBP1-87157)

Discover more about diseases related to RAP80 Antibody (NBP1-87157).
 

Pathways for RAP80 Antibody (NBP1-87157)

View related products by pathway.

PTMs for RAP80 Antibody (NBP1-87157)

Learn more about PTMs related to RAP80 Antibody (NBP1-87157).
 

Research Areas for RAP80 Antibody (NBP1-87157)

Find related products by research area.

Blogs on RAP80

There are no specific blogs for RAP80, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RAP80 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol UIMC1
Entrez