Ran Antibody


Western Blot: Ran Antibody [NBP1-58107] - HepG2 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

Ran Antibody Summary

Synthetic peptides corresponding to RAN(RAN, member RAS oncogene family) The peptide sequence was selected from the middle region of RAN. Peptide sequence NLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVVMDPA.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against RAN and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Ran Antibody

  • Androgen receptor-associated protein 24
  • ARA24Gsp1
  • GTPase Ran
  • GTP-binding nuclear protein Ran
  • guanosine triphosphatase Ran
  • member RAS oncogene family
  • OK/SW-cl.81
  • RAN, member RAS oncogene family
  • RanGTPase
  • Ras-like protein TC4
  • Ras-related nuclear protein
  • TC4


RAN (ras-related nuclear protein) is a small GTP binding protein belonging to the RAS superfamily that is essential for the translocation of RNA and proteins through the nuclear pore complex. The RAN protein is also involved in control of DNA synthesis an


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, ChHa, Pm
Applications: WB, EM, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP, PLA
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: WB, ICC/IF
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB
Species: Hu
Applications: CyTOF-reported, ICC, ICFlow
Species: Hu, Pm
Applications: WB, IHC, IHC-P
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, Flow, ICC/IF

Publications for Ran Antibody (NBP1-58107) (0)

There are no publications for Ran Antibody (NBP1-58107).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Ran Antibody (NBP1-58107) (0)

There are no reviews for Ran Antibody (NBP1-58107). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Ran Antibody (NBP1-58107) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Ran Products

Bioinformatics Tool for Ran Antibody (NBP1-58107)

Discover related pathways, diseases and genes to Ran Antibody (NBP1-58107). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Ran Antibody (NBP1-58107)

Discover more about diseases related to Ran Antibody (NBP1-58107).

Pathways for Ran Antibody (NBP1-58107)

View related products by pathway.

PTMs for Ran Antibody (NBP1-58107)

Learn more about PTMs related to Ran Antibody (NBP1-58107).

Research Areas for Ran Antibody (NBP1-58107)

Find related products by research area.

Blogs on Ran.

Transportin 1 and heterogeneous nuclear ribonucleoprotein D (hnRNPD)
Transportin 1, also known as Karyopherin- beta 2 or Importin- beta 2, is part of the beta -karyopherins family, which consists of importins and exportins responsible for the active transport of proteins between the nucleus and cytoplasm.  Transportin 1 is co...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Ran Antibody and receive a gift card or discount.


Gene Symbol RAN