Ran Antibody

Images

 
Western Blot: Ran Antibody [NBP1-58107] - HepG2 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit

Order Details

Ran Antibody Summary

Immunogen
Synthetic peptides corresponding to RAN(RAN, member RAS oncogene family) The peptide sequence was selected from the middle region of RAN. Peptide sequence NLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVVMDPA.
Clonality
Polyclonal
Host
Rabbit
Gene
RAN
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against RAN and was validated on Western blot.

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Ran Antibody

  • Androgen receptor-associated protein 24
  • ARA24Gsp1
  • GTPase Ran
  • GTP-binding nuclear protein Ran
  • guanosine triphosphatase Ran
  • member RAS oncogene family
  • OK/SW-cl.81
  • RAN, member RAS oncogene family
  • RanGTPase
  • Ras-like protein TC4
  • Ras-related nuclear protein
  • TC4

Background

RAN (ras-related nuclear protein) is a small GTP binding protein belonging to the RAS superfamily that is essential for the translocation of RNA and proteins through the nuclear pore complex. The RAN protein is also involved in control of DNA synthesis an

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85638
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-79814
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP1-82520
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-74480
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB400-148
Species: Hu, Mu, Rt, Po, ChHa, Pm
Applications: WB, EM, ICC/IF, IHC, IHC-P
NB100-79802
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC-P, IP, PLA
NBP2-02623
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF6260
Species: Hu
Applications: WB
NB110-68800
Species: Hu, Mu
Applications: WB, ICC/IF
MAB3429
Species: Hu
Applications: WB
NBP1-83213
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15087
Species: Hu, Mu
Applications: WB
MAB1259
Species: Hu
Applications: ICC, ICFlow
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP2-25160
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
NBP1-58107
Species: Hu
Applications: WB

Publications for Ran Antibody (NBP1-58107) (0)

There are no publications for Ran Antibody (NBP1-58107).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Ran Antibody (NBP1-58107) (0)

There are no reviews for Ran Antibody (NBP1-58107). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Ran Antibody (NBP1-58107) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Ran Antibody Products

Related Products by Gene

Bioinformatics Tool for Ran Antibody (NBP1-58107)

Discover related pathways, diseases and genes to Ran Antibody (NBP1-58107). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Ran Antibody (NBP1-58107)

Discover more about diseases related to Ran Antibody (NBP1-58107).
 

Pathways for Ran Antibody (NBP1-58107)

View related products by pathway.

PTMs for Ran Antibody (NBP1-58107)

Learn more about PTMs related to Ran Antibody (NBP1-58107).
 

Research Areas for Ran Antibody (NBP1-58107)

Find related products by research area.

Blogs on Ran

There are no specific blogs for Ran, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol RAN
Uniprot

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-58107 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought

Ran Recombinant Protein
H00005901-P01-10ug
Ran RNAi
H00005901-R01-20nmol