RAD9B Antibody

Images

 
Immunohistochemistry-Paraffin: RAD9B Antibody [NBP1-83452] - Staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RAD9B Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RHGIKRTHNICFQESQPLQVIFDKNVCTNTLMIQPRLLADAIVLFTSSQEEVTLAVTPLNFCLKSSNEESMDLSNAVHSEMFVGSDEFDFFQIGMD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RAD9B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
RAD9B Protein (NBP1-83452PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RAD9B Antibody

  • cell cycle checkpoint control protein RAD9B homolog
  • cell cycle checkpoint control protein RAD9B
  • DNA repair exonuclease rad9 homolog B
  • FLJ40346
  • hRAD9B
  • MGC75426
  • RAD9 homolog B (S. pombe)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB120-13600
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-89445
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24457
Species: Hu, Mu, Pm
Applications: WB, IHC-P
NBP1-02812
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-56320
Species: Hu
Applications: WB
NB100-56585
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-308
Species: Hu
Applications: WB, Func, ICC/IF, IP
NBP2-01020
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-464
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, PLA
NB100-217
Species: Hu, Mu
Applications: WB, IP, PLA
NBP2-03417
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-13266
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-247
Species: Hu
Applications: WB, IHC-P, IP, PLA
NBP1-59904
Species: Hu
Applications: WB, IHC, IHC-P
NB100-230
Species: Hu
Applications: WB, IP, PLA
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP1-87425
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for RAD9B Antibody (NBP1-83452) (0)

There are no publications for RAD9B Antibody (NBP1-83452).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RAD9B Antibody (NBP1-83452) (0)

There are no reviews for RAD9B Antibody (NBP1-83452). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for RAD9B Antibody (NBP1-83452) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RAD9B Products

Bioinformatics Tool for RAD9B Antibody (NBP1-83452)

Discover related pathways, diseases and genes to RAD9B Antibody (NBP1-83452). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RAD9B Antibody (NBP1-83452)

Discover more about diseases related to RAD9B Antibody (NBP1-83452).
 

Pathways for RAD9B Antibody (NBP1-83452)

View related products by pathway.

Research Areas for RAD9B Antibody (NBP1-83452)

Find related products by research area.

Blogs on RAD9B

There are no specific blogs for RAD9B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RAD9B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RAD9B