RAD52 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RAD52. Source: E. coli Amino Acid Sequence: ILGGRDSHPAAGGGSVLCFGQCQYTAEEYQAIQKALRQRLGPEYISSRMAGGGQKVCYIEGHRVINLANEMFGYNGWAHSITQQNVDFVDLNNGKFYVGVCAFVRVQLKDGSYHEDVGYGVSE Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
RAD52 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-58116. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
31 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for RAD52 Recombinant Protein Antigen
Background
DNA double-strand breaks are generated by ionizing radiation and endogenously produced radicals, and they often are repaired through the RAD52 homologous recombination pathway. The RAD52 family includes RAD51, RAD52, RAD54, RAD54B and MRE11 genes. Rad51 and Rad52 proteins perform the key steps in homologous recombination (HR), including the search for DNA homology and strand exchange, through similar mechanisms. Mre11 functions in both non-homologous end joining, and meiotic HR, and it is essential in mitosis for chromosome maintenance. Rad54 belongs to the SWI2/SNF2 subfamily of ATPases, which includes the DNA helicases involved in replication, recombination, and repair, as it contains seven amino acid sequence motifs that are largely conserved. Rad54 ATPase activity is dependent on double-stranded (ds) DNA, and the ATPase activity of Rad54 is not absolutely required for its DNA repair function, suggesting that these activities occur at distinct regions of the molecule. RAD54B is significantly homologous to the RAD54 recombination gene. Expression of RAD54B is highest in testis and spleen, which are active in both meiotic and mitotic recombination.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 3 months from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Ch, Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, KD, PLA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, In vitro, KD, WB
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, IHC, IHC-P, KD, ELISA(Cap), S-ELISA, WB
Species: Ca, Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: IHC, WB
Species: Bv, Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: ChHa, Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Ha, Hu, Mu, Rt
Applications: ChIP, IP, WB
Species: Hu, Pm, Mu, Rt
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, KD, PAGE, Single-Cell Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, KD, WB
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IP, WB
Species: Hu, Mu
Applications: ICC/IF, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: Func, ICC/IF, IP, In vitro, KO, WB
Publications for RAD52 Recombinant Protein Antigen (NBP2-58116PEP) (0)
There are no publications for RAD52 Recombinant Protein Antigen (NBP2-58116PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for RAD52 Recombinant Protein Antigen (NBP2-58116PEP) (0)
There are no reviews for RAD52 Recombinant Protein Antigen (NBP2-58116PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for RAD52 Recombinant Protein Antigen (NBP2-58116PEP) (0)
Additional RAD52 Products
Research Areas for RAD52 Recombinant Protein Antigen (NBP2-58116PEP)
Find related products by research area.
|
Blogs on RAD52