RAD18 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: RAD18 Antibody [NBP2-58893] - Staining of human cell line U-2 OS shows localization to nucleoplasm & nuclear bodies.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RAD18 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: KEHGLSIQGNKQQLIKRHQEFVHMYNAQCDALHPKSAAEIVQEIENIEKTRMRLEASKLNESVMVFTKDQTEKEIDEIHSKYRKKHKSEFQLLVDQARKGYKKIAGMSQKTVTITKEDESTE
Specificity
Specificity of human RAD18 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RAD18
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Reactivity Notes

Rat 82%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for RAD18 Antibody

  • EC 6.3.2.-
  • hHR18
  • hRAD18
  • postreplication repair protein hRAD18p
  • Postreplication repair protein RAD18
  • RAD18 homolog (S. cerevisiae)
  • RAD18, S. cerevisiae, homolog
  • RING finger protein 73
  • RNF73E3 ubiquitin-protein ligase RAD18

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NB100-565
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP, KO
NBP2-58116
Species: Hu
Applications: WB, ICC/IF, PLA, KD
NB100-469
Species: Hu, Mu
Applications: WB, ICC/IF, IP
NB100-148
Species: Hu, Mu, Rt, Ce, Ch
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, PLA, KD
NB100-56360
Species: Hu
Applications: WB
NBP2-13266
Species: Hu
Applications: ICC/IF, IHC, IHC-P
PP-H4417-00
Species: Hu
Applications: WB, IP, DirELISA
AF2880
Species: Hu, Mu
Applications: WB
NB100-150
Species: Hu, Mu
Applications: WB, ICC/IF, IP
NB100-60424
Species: Hu
Applications: WB, IP
NBP1-89150
Species: Hu, Rt
Applications: WB, IHC, IHC-P
H00011026-M01
Species: Hu
Applications: WB, ELISA
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBL1-15290
Species: Hu
NBP2-74883
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, CyTOF-ready
NBP2-58893
Species: Hu
Applications: ICC/IF

Publications for RAD18 Antibody (NBP2-58893) (0)

There are no publications for RAD18 Antibody (NBP2-58893).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RAD18 Antibody (NBP2-58893) (0)

There are no reviews for RAD18 Antibody (NBP2-58893). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for RAD18 Antibody (NBP2-58893) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional RAD18 Products

Bioinformatics Tool for RAD18 Antibody (NBP2-58893)

Discover related pathways, diseases and genes to RAD18 Antibody (NBP2-58893). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RAD18 Antibody (NBP2-58893)

Discover more about diseases related to RAD18 Antibody (NBP2-58893).
 

Pathways for RAD18 Antibody (NBP2-58893)

View related products by pathway.

PTMs for RAD18 Antibody (NBP2-58893)

Learn more about PTMs related to RAD18 Antibody (NBP2-58893).
 

Research Areas for RAD18 Antibody (NBP2-58893)

Find related products by research area.

Blogs on RAD18

There are no specific blogs for RAD18, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RAD18 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RAD18