RAC2 Antibody (3B8)

Images

 
Western Blot: RAC2 Antibody (3B8) [H00005880-M08] - Analysis of RAC2 expression in transfected 293T cell line by RAC2 monoclonal antibody (M08), clone 3B8. Lane 1: RAC2 transfected lysatE (21.4 KDa). Lane 2: ...read more
Immunocytochemistry/ Immunofluorescence: RAC2 Antibody (3B8) [H00005880-M08] - Analysis of monoclonal antibody to RAC2 on HeLa cell. Antibody concentration 10 ug/ml
Sandwich ELISA: RAC2 Antibody (3B8) [H00005880-M08] - Detection limit for recombinant GST tagged RAC2 is 1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
3B8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

RAC2 Antibody (3B8) Summary

Immunogen
RAC2 (AAH01485.1, 1 a.a. - 192 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDSKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASYENVRAKWFPEVRHHCPSTPIILVGTKLDLRDDKDTIEKLKEKKLAPITYPQGLALAKEIDSVKYLECSALTQRGLKTVFDEAIRAVLCPQPTRQQKRACSLL
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
RAC2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
It has been used for ELISA and WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RAC2 Antibody (3B8)

  • Gx
  • HSPC022
  • ras-related C3 botulinum toxin substrate 2 (rho family, small GTP bindingprotein Rac2)
  • rho family, small GTP binding protein Rac2
  • small GTP-bindingprotein Rac2)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-91266
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, ICC
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-14907
Species: Mu, Rt
Applications: WB, IHC, IHC-P
NB100-790
Species: Hu, Mu, Po
Applications: WB, IHC-P, PEP-ELISA
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
NB100-91273
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82542
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02300
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-41291
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-314
Species: Hu
Applications: WB, IP, PLA
NBP2-32058
Species: Hu
Applications: WB, IHC, IHC-P
AF3795
Species: Hu
Applications: WB, IP
AF5675
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-22377
Species: Hu
Applications: WB, IHC, IHC-P
MAB1904
Species: Hu
Applications: WB, IHC, ICC
H00011214-M10
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP2-13676
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5758
Species: Hu
Applications: WB, IHC, ICC
H00005880-M08
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for RAC2 Antibody (H00005880-M08) (0)

There are no publications for RAC2 Antibody (H00005880-M08).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RAC2 Antibody (H00005880-M08) (0)

There are no reviews for RAC2 Antibody (H00005880-M08). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RAC2 Antibody (H00005880-M08) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RAC2 Products

Bioinformatics Tool for RAC2 Antibody (H00005880-M08)

Discover related pathways, diseases and genes to RAC2 Antibody (H00005880-M08). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RAC2 Antibody (H00005880-M08)

Discover more about diseases related to RAC2 Antibody (H00005880-M08).
 

Pathways for RAC2 Antibody (H00005880-M08)

View related products by pathway.

PTMs for RAC2 Antibody (H00005880-M08)

Learn more about PTMs related to RAC2 Antibody (H00005880-M08).
 

Research Areas for RAC2 Antibody (H00005880-M08)

Find related products by research area.

Blogs on RAC2

There are no specific blogs for RAC2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RAC2 Antibody (3B8) and receive a gift card or discount.

Bioinformatics

Gene Symbol RAC2
Uniprot