RAB9A Recombinant Protein Antigen

Images

 
There are currently no images for RAB9A Protein (NBP1-87172PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

RAB9A Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RAB9A.

Source: E. coli

Amino Acid Sequence: SDCCLLTFSVDDSQSFQNLSNWKKEFIYYADVKEPESFPFVILGNKIDISERQVSTEEAQAWCRDNGDYPYFETSAKDATNVAAAFEEAVRRVLATEDRSDHLIQTDTVNLHRKP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
RAB9A
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87172.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for RAB9A Recombinant Protein Antigen

  • RAB9A, member RAS oncogene family
  • RAB9RAB9, member RAS oncogene family
  • ras-related protein Rab-9A

Background

Rab proteins are a family of Ras-like GTPases involved in intracellular compartment protein transport. Different members of the 40+ member rab family are responsible for docking and fusion of transport vesicles between different compartments within the cell. Rab 9 is required for trafficking mannose 6-phosphate receptor between the late endosome to trans-Golgi network (TGN). By facilitating receptor transport, rab 9 enables cells to efficiently recycle important cellular trafficking components. It is functionally necessary for rab 9, like other rab family members, to be prenylated by two 20-carbon geranylgeranyl groups at the C-terminus. Most prenylated rab 9 is membrane bound, however, 10-20% of the cellular pool of rab 9 is bound to GDP dissociation inhibitor-alpha (GDI-alpha) in the cytosol. GDI recycles prenylated, GDP bound rab 9 from their fusion targets back to their membranes of origin.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87174
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KD, WB
H00338382-M01
Species: Hu
Applications: ELISA, IP, WB
NB110-40764
Species: Hu, Mu, Po, Pm
Applications: ICC/IF, WB
NBP1-91991
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB400-148
Species: ChHa, Ha, Hu, Mu, Po, Pm, Rt
Applications: EM, ICC/IF, IHC,  IHC-P, IP, KD, KO, WB
NB120-13253
Species: Bv, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC-FrFl, IHC,  IHC-P, IP, WB
NBP2-49320
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-83220
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, Simple Western, WB
NBP1-33110
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KO, WB
NB120-19294
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-31528
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
MAB8306
Species: Hu
Applications: IHC, WB
NB300-514
Species: Bv, Hu, Mu, Pm, Rt
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, IP, WB
NBP3-03436
Species: Hu, Mu
Applications: ELISA, IHC,  IHC-P, WB
NBP1-32956
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP1-55113
Species: Hu, Pm, Mu
Applications: IHC,  IHC-P, WB
NBP1-49643
Species: Bv, Hu, Pm
Applications: Flow-IC, Flow, IB, ICC/IF, IHC,  IHC-P, KO, WB
NBP2-36776
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP2-21577
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KD, WB
NB500-249
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KD, Simple Western, WB

Publications for RAB9A Protein (NBP1-87172PEP) (0)

There are no publications for RAB9A Protein (NBP1-87172PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RAB9A Protein (NBP1-87172PEP) (0)

There are no reviews for RAB9A Protein (NBP1-87172PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for RAB9A Protein (NBP1-87172PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RAB9A Products

Research Areas for RAB9A Protein (NBP1-87172PEP)

Find related products by research area.

Blogs on RAB9A

There are no specific blogs for RAB9A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our RAB9A Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol RAB9A