RAB8B Antibody


Western Blot: RAB8B Antibody [NBP1-69095] - HepG2 Cell Lysate 1ug/ml Gel Concentration 12%
Western Blot: RAB8B Antibody [NBP1-69095] - 1. Human Cervical Cancer Cell lysate (15ug) 2. Monkey Fibroblast Cell lysate (15ug) 3. Human Cervical Cancer Cell transfected with mouse Rab8B-GFP (15ug) Primary Dilution: 1 : ...read more

Product Details

Reactivity Hu, MkSpecies Glossary
Applications WB

Order Details

RAB8B Antibody Summary

Synthetic peptides corresponding to RAB8B (RAB8B, member RAS oncogene family) The peptide sequence was selected from the C terminal of RAB8B. Peptide sequence SAKSSANVEEAFFTLARDIMTKLNRKMNDSNSAGAGGPVKITENRSKKTS.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against RAB8B and was validated on Western blot.
Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for RAB8B Antibody

  • FLJ38125
  • RAB-8b protein
  • RAB8B, member RAS oncogene family
  • ras-related protein Rab-8B


RAB proteins, like RAB8B, are low molecular mass monomeric GTPases that localize on the cytoplasmic surfaces of distinct membrane-bound organelles. RAB proteins function in intracellular vesicle transport by aiding in the docking and/or fusion of vesicles with their target membranes (summary by Chen et al., 1997 [PubMed 9030196]).


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Ze
Applications: WB, ELISA, ICC/IF, IHC-P
Species: Hu, Mu, Rt, Ca
Applications: WB, Flow, ICC/IF, IP
Species: Mu
Applications: WB, ICC/IF, IHC-P, PEP-ELISA
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, IHC-P, RNAi
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IP
Species: Hu
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
Species: Hu, Mu, Rt, Rb, Xp, Ze
Applications: WB, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mk
Applications: WB

Publications for RAB8B Antibody (NBP1-69095) (0)

There are no publications for RAB8B Antibody (NBP1-69095).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RAB8B Antibody (NBP1-69095) (0)

There are no reviews for RAB8B Antibody (NBP1-69095). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RAB8B Antibody (NBP1-69095) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional RAB8B Products

Bioinformatics Tool for RAB8B Antibody (NBP1-69095)

Discover related pathways, diseases and genes to RAB8B Antibody (NBP1-69095). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RAB8B Antibody (NBP1-69095)

Discover more about diseases related to RAB8B Antibody (NBP1-69095).

Pathways for RAB8B Antibody (NBP1-69095)

View related products by pathway.

PTMs for RAB8B Antibody (NBP1-69095)

Learn more about PTMs related to RAB8B Antibody (NBP1-69095).

Research Areas for RAB8B Antibody (NBP1-69095)

Find related products by research area.

Blogs on RAB8B

There are no specific blogs for RAB8B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our RAB8B Antibody and receive a gift card or discount.


Gene Symbol RAB8B