RAB8B Antibody

Western Blot: RAB8B Antibody [NBP1-69095] - HepG2 Cell Lysate 1ug/ml Gel Concentration 12%

Western Blot: RAB8B Antibody [NBP1-69095] - 1. Human Cervical Cancer Cell lysate (15ug) 2. Monkey Fibroblast Cell lysate (15ug) 3. Human Cervical Cancer Cell transfected with mouse Rab8B-GFP (15ug) Primary Dilution: 1 : 1000 Secondary Antibody: goat anti-Rabbit Secondary Dilution: 1 : 40,000.

• Reactivity: Hu, Mu, Pm
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

RAB8B Antibody Summary

• Immunogen: Synthetic peptides corresponding to RAB8B (RAB8B, member RAS oncogene family) The peptide sequence was selected from the C terminal of RAB8B. Peptide sequence SAKSSANVEEAFFTLARDIMTKLNRKMNDSNSAGAGGPVKITENRSKKTS. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RAB8B
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Application Notes: This is a rabbit polyclonal antibody against RAB8B and was validated on Western blot.
• Theoretical MW: 23 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Purity: Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for RAB8B Antibody

• FLJ38125
• RAB-8b protein
• RAB8B, member RAS oncogene family
• ras-related protein Rab-8B

Background

RAB proteins, like RAB8B, are low molecular mass monomeric GTPases that localize on the cytoplasmic surfaces of distinct membrane-bound organelles. RAB proteins function in intracellular vesicle transport by aiding in the docking and/or fusion of vesicles with their target membranes (summary by Chen et al., 1997 [PubMed 9030196]).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RAB8B