Novus Biologicals products are now on bio-techne.com

RAB43 Antibody

Images

 
Western Blot: RAB43 Antibody [NBP3-09514] - Western blot analysis of RAB43 in Human OVCAR-3 Whole Cell. Antibody dilution at 1 ug/mL

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Concentration
0.5 mg/ml

Order Details

RAB43 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human RAB43 (NP_940892.1). Peptide sequence ETSAKDSSNVEEAFLRVATELIMRHGGPLFSEKSPDHIQLNSKDIGEGWG
Clonality
Polyclonal
Host
Rabbit
Gene
RAB43
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Purity
Affinity purified

Alternate Names for RAB43 Antibody

  • MGC90481
  • RAB11B
  • RAB41ISY1
  • RAB43, member RAS oncogene family
  • Ras-related protein Rab-41
  • ras-related protein Rab-43

Background

RAB43 belongs to the small GTPase superfamily. Rab family.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-49320
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-51599
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, KD, WB
NBP1-91991
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-55113
Species: Hu, Pm, Mu
Applications: IHC, IHC-P, WB
NBP2-20839
Species: Hu
Applications: WB
2914-HT
Species: Hu
Applications: BA
NBP1-81855
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KO, WB
NBP1-33110
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
NBP2-26504
Species: Hu, Mu, Rt
Applications: B/N, Func-Inh, In vitro, In vivo
NB120-13253
Species: Bv, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC-FrFl, IHC, IHC-P, IP, WB
236-EG
Species: Hu
Applications: BA
NBP1-33560
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KO, WB
NBP2-45499
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
H00008826-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, S-ELISA, WB
NBP1-82949
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00053916-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP2-93131
Species: Hu, Mu, Rt
Applications: WB
AF1067
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Neut, WB
NBP3-09514
Species: Hu
Applications: WB

Publications for RAB43 Antibody (NBP3-09514) (0)

There are no publications for RAB43 Antibody (NBP3-09514).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RAB43 Antibody (NBP3-09514) (0)

There are no reviews for RAB43 Antibody (NBP3-09514). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RAB43 Antibody (NBP3-09514) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RAB43 Products

Research Areas for RAB43 Antibody (NBP3-09514)

Find related products by research area.

Blogs on RAB43

There are no specific blogs for RAB43, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RAB43 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RAB43