RAB30 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: RAB30 Antibody [NBP2-30410] - Immunofluorescent staining of human cell line U-2 OS shows localization to vesicles.
Immunohistochemistry: RAB30 Antibody [NBP2-30410] - Staining of human rectum shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RAB30 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: RSANALILTYDITCEESFRCLPEWLREIEQYASNKVITVLVG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RAB30
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RAB30 Protein (NBP2-30410PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RAB30 Antibody

  • RAB30, member RAS oncogene family
  • ras-related protein Rab-30

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-74398
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91991
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-52084
Species: Hu, Mu, Rt
Applications: WB, IHC-P, PEP-ELISA
AF2065
Species: Mu
Applications: WB, Simple Western, ICC
NBP1-80859
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
21740002
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
AF3059
Species: Mu
Applications: WB, Simple Western, ICC
NBP1-31589
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-31793
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-29942
Species: Hu
Applications: WB, Flow, IHC-P
NB300-621
Species: Hu, Rt, Bv, Ca, Ha, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IM, IP
H00057799-T01
Species: Hu
H00338382-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NBP1-05048
Species: Hu, Mu, Rt, Bv, Ca, Sh
Applications: WB, ICC/IF
NBP2-07079
Species: Hu
NBP1-87311
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF6214
Species: Hu, Mu
Applications: WB
NBP2-45926
Species: Hu, Mk
Applications: WB, IHC, IHC-P, IF
NBP2-30410
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for RAB30 Antibody (NBP2-30410) (0)

There are no publications for RAB30 Antibody (NBP2-30410).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RAB30 Antibody (NBP2-30410) (0)

There are no reviews for RAB30 Antibody (NBP2-30410). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for RAB30 Antibody (NBP2-30410) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RAB30 Products

Bioinformatics Tool for RAB30 Antibody (NBP2-30410)

Discover related pathways, diseases and genes to RAB30 Antibody (NBP2-30410). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RAB30 Antibody (NBP2-30410)

Discover more about diseases related to RAB30 Antibody (NBP2-30410).
 

Pathways for RAB30 Antibody (NBP2-30410)

View related products by pathway.

Research Areas for RAB30 Antibody (NBP2-30410)

Find related products by research area.

Blogs on RAB30

There are no specific blogs for RAB30, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RAB30 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RAB30
Uniprot