RAB22A Antibody

Images

 
Western Blot: RAB22A Antibody [NBP1-56889] - Reccomended Titration: 0.2 - 1 ug/ml Positive Control: MCF7 cell lysate RAB22A is strongly supported by BioGPS gene expression data to be expressed in Human MCF7 cells

Product Details

Summary
Reactivity Hu, Mu, Rt, Po, Bv, Ca, Eq, Gp, Rb, ZeSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RAB22A Antibody Summary

Immunogen
Synthetic peptides corresponding to RAB22A(RAB22A, member RAS oncogene family) The peptide sequence was selected from the middle region of RAB22A. Peptide sequence IFVETSAKNAININELFIEISRRIPSTDANLPSGGKGFKLRRQPSEPKRS. The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Rat (100%), Porcine (100%), Bovine (100%), Guinea Pig (93%), Rabbit (100%), Zebrafish (100%), Canine (100%), Equine (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RAB22A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
Application Notes
This is a rabbit polyclonal antibody against RAB22A and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for RAB22A Antibody

  • GTP-binding protein RAB22A
  • MGC16770
  • RAB22
  • Rab-22
  • RAB22A, member RAS oncogene family
  • ras-related protein Rab-22A

Background

The protein encoded by this gene is a member of the RAB family of small GTPases. The GTP-bound form of the encoded protein has been shown to interact with early-endosomal antigen 1, and may be involved in the trafficking of and interaction between endosom

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB120-13253
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
NBP1-91991
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-49938
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP1-33110
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KO
NBP1-80859
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-36568
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, Flow-IC
NB100-74519
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49320
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45497
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, IHC, IF
NBP1-87174
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
H00338382-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-51634
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
NBP1-82588
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF6260
Species: Hu
Applications: WB
NBP2-94657
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-95233
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02599
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00004218-M02
Species: Hu, Mu, Ze
Applications: WB, ELISA, ICC/IF

Publications for RAB22A Antibody (NBP1-56889) (0)

There are no publications for RAB22A Antibody (NBP1-56889).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RAB22A Antibody (NBP1-56889) (0)

There are no reviews for RAB22A Antibody (NBP1-56889). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RAB22A Antibody (NBP1-56889) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional RAB22A Products

Bioinformatics Tool for RAB22A Antibody (NBP1-56889)

Discover related pathways, diseases and genes to RAB22A Antibody (NBP1-56889). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RAB22A Antibody (NBP1-56889)

Discover more about diseases related to RAB22A Antibody (NBP1-56889).
 

Pathways for RAB22A Antibody (NBP1-56889)

View related products by pathway.

PTMs for RAB22A Antibody (NBP1-56889)

Learn more about PTMs related to RAB22A Antibody (NBP1-56889).
 

Research Areas for RAB22A Antibody (NBP1-56889)

Find related products by research area.

Blogs on RAB22A

There are no specific blogs for RAB22A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RAB22A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RAB22A
Uniprot