QPRT Antibody (5D11)

Images

 
Western Blot: QPRT Antibody (5D11) [H00023475-M01] - QPRT monoclonal antibody (M01), clone 5D11 Analysis of QPRT expression in HepG2.
Immunohistochemistry-Paraffin: QPRT Antibody (5D11) [H00023475-M01] - Analysis of monoclonal antibody to QPRT on formalin-fixed paraffin-embedded human tonsil. Antibody concentration 3 ug/ml.
Sandwich ELISA: QPRT Antibody (5D11) [H00023475-M01] - Detection limit for recombinant GST tagged QPRT is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, AvSpecies Glossary
Applications WB, ELISA, IHC, IHC-P, S-ELISA
Clone
5D11
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

QPRT Antibody (5D11) Summary

Immunogen
QPRT (NP_055113, 198 a.a. ~ 297 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VEVECSSLQEAVQAAEAGADLVLLDNFKPEELHPTATVLKAQFPSVAVEASGGITLDNLPQFCGPHIDVISMGMLTQAAPALDFSLKLFAKEVAPVPKIH
Specificity
QPRT - quinolinate phosphoribosyltransferase (nicotinate-nucleotide pyrophosphorylase (carboxylating))
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
QPRT
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin) and ELISA.
Publications
Read Publications using H00023475-M01.

Reactivity Notes

Human. Other species not tested. Avian reactivity reported in scientific literature (PMID: 23761975)

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for QPRT Antibody (5D11)

  • EC 2.4.2.19
  • nicotinate-nucleotide pyrophosphorylase (carboxylating)
  • QAPRTase
  • QPRTasenicotinate-nucleotide pyrophosphorylase [carboxylating]
  • Quinolinate phosphoribosyltransferase [decarboxylating]
  • quinolinate phosphoribosyltransferase

Background

This gene encodes a key enzyme in catabolism of quinolinate, an intermediate in the tryptophan-nicotinamide adenine dinucleotide pathway. Quinolinate acts as a most potent endogenous exitotoxin to neurons. Elevation of quinolinate levels in the brain has been linked to the pathogenesis of neurodegenerative disorders such as epilepsy, Alzheimer's disease, and Huntington's disease.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-81838
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP1-86108
Species: Hu
Applications: IHC, IHC-P, WB
H00006999-B01P
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-87243
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NB300-537
Species: Bv, Hu, Mu, Rb, Rt
Applications: ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, WB
NBP1-85892
Species: Hu
Applications: IHC, IHC-P
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NBP1-47659
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-31348
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-01763
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
H00002038-M01
Species: Hu
Applications: ELISA, ICC/IF, WB
H00005555-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP2-23368
Species: Hu
Applications: PAGE
NB100-1793
Species: Hu, Pm, Mu, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
NBP1-86615
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-31133
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-88370
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-87702
Species: Hu
Applications: IHC, IHC-P, Simple Western, WB
NBP2-58917
Species: Hu
Applications: IHC, IHC-P, WB
H00023475-M01
Species: Hu, Av
Applications: WB, ELISA, IHC, IHC-P, S-ELISA

Publications for QPRT Antibody (H00023475-M01)(3)

Reviews for QPRT Antibody (H00023475-M01) (0)

There are no reviews for QPRT Antibody (H00023475-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for QPRT Antibody (H00023475-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional QPRT Products

Bioinformatics Tool for QPRT Antibody (H00023475-M01)

Discover related pathways, diseases and genes to QPRT Antibody (H00023475-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for QPRT Antibody (H00023475-M01)

Discover more about diseases related to QPRT Antibody (H00023475-M01).
 

Pathways for QPRT Antibody (H00023475-M01)

View related products by pathway.

PTMs for QPRT Antibody (H00023475-M01)

Learn more about PTMs related to QPRT Antibody (H00023475-M01).

Blogs on QPRT

There are no specific blogs for QPRT, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our QPRT Antibody (5D11) and receive a gift card or discount.

Bioinformatics

Gene Symbol QPRT
Entrez
OMIM
Uniprot