Pyruvate Dehydrogenase E2 Antibody - BSA Free

Western Blot: Pyruvate Dehydrogenase E2 Antibody [NBP1-54795] - Reccomended Titration: 5.0 ug/ml Positive Control: Jurkat cell lysate

Immunohistochemistry-Paraffin: Pyruvate Dehydrogenase E2 Antibody [NBP1-54795] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.

Western Blot: Pyruvate Dehydrogenase E2 Antibody [NBP1-54795] - Sample Type : Huh7 lysate (50ug) Primary Antibody Dilution : 1:200 Image Submitted By : Partha Kasturi University of Kansas Medical Center

Western Blot: Pyruvate Dehydrogenase E2 Antibody [NBP1-54795] - Sample Tissue: Human Jurkat Antibody Dilution: 1.0 ug/ml

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 1 mg/ml

Pyruvate Dehydrogenase E2 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to DLAT(dihydrolipoamide S-acetyltransferase (E2 component of pyruvate dehydrogenase complex)) The peptide sequence was selected from the N terminal of DLAT. Peptide sequence WTPSSGATPRNRLLLQLLGSPGRRYYSLPPHQKVPLPSLSPTMQAGTIAR The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DLAT
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 1 mg/ml
• Purity: Protein A purified

Alternate Names for Pyruvate Dehydrogenase E2 Antibody - BSA Free

• 70 kDa mitochondrial autoantigen of primary biliary cirrhosis
• dihydrolipoamide S-acetyltransferase
• DLTA
• E2 component of pyruvate dehydrogenase complex
• EC 2.3.1
• M2 antigen complex 70 kDa subunit
• PBC
• PDC-E2EC 2.3.1.12
• PDCE2mitochondrial

Background

DLAT is dihydrolipoamide acetyltransferase, the E2 subunit of the mammalian pyruvate dehydrogenase complex of the inner mitochondrial membrane. Patients with primary biliary cirrhosis show autoantibodies to DLAT.The DLAT gene encodes dihydrolipoamide acetyltransferase (EC 2.3.1.12), the E2 subunit of the mammalian pyruvate dehydrogenase complex (PDC; EC 1.2.4.1) of the inner mitochondrial membrane. Patients with primary biliary cirrhosis (PBC; MIM 109720) show autoantibodies to DLAT.[supplied by OMIM].

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DLAT
• Uniprot:
  • Q86YI5(Human)