Pygopus-1 Antibody (3E1)

Images

 
Western Blot: Pygopus-1 Antibody (3E1) [H00026108-M13] - Analysis of PYGO1 expression in transfected 293T cell line by PYGO1 monoclonal antibody (M13), clone 3E1. Lane 1: PYGO1 transfected lysate (Predicted MW: 46.09 ...read more
Sandwich ELISA: Pygopus-1 Antibody (3E1) [H00026108-M13] - Detection limit for recombinant GST tagged PYGO1 is 0.1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, S-ELISA
Clone
3E1
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Pygopus-1 Antibody (3E1) Summary

Immunogen
PYGO1 (NP_056432, 101 a.a. ~ 200 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. YSTFRMPPHVPPRMSSPYCGPYSLRNQPHPFPQNPLGMGFNRPHAFNFGPHDNSSFGNPSYNNALSQNVNMPNQHFRQNPAENFSQIPPQNASQVSNPDL
Specificity
PYGO1 - pygopus homolog 1 (Drosophila) (3E1)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PYGO1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Sandwich ELISA
Application Notes
Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Pygopus-1 Antibody (3E1)

  • DKFZp547G0910
  • Pygo1
  • pygopus 1
  • pygopus homolog 1 (Drosophila)
  • pygopus homolog 1
  • Pygopus1
  • Pygopus-1
  • pygopus-like protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-46171
Species: Hu, Mu, Ze
Applications: WB, ChIP, IHC, IHC-P, IP
NBP2-30472
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP1-89679
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-14350
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP1-51575
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB600-302
Species: Hu, Mu, Bv, Dr
Applications: WB, Simple Western, ChIP, ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, S-ELISA, Flow-IC
H00051176-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, PLA, RNAi, S-ELISA
AF3287
Species: Hu, Mu, Rt
Applications: WB
423-F8/CF
Species: Hu, Mu
NB100-56340
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P, KO
NBP1-30141
Species: Hu, Mu, Rt, Po, Ce, Dr, In, Ma, Ye
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-61712
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P
NBP1-84019
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-91875
Species: Hu, Mu
Applications: IHC, IHC-P
H00026108-M13
Species: Hu
Applications: WB, ELISA, S-ELISA

Publications for Pygopus-1 Antibody (H00026108-M13) (0)

There are no publications for Pygopus-1 Antibody (H00026108-M13).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Pygopus-1 Antibody (H00026108-M13) (0)

There are no reviews for Pygopus-1 Antibody (H00026108-M13). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Pygopus-1 Antibody (H00026108-M13) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Pygopus-1 Products

Bioinformatics Tool for Pygopus-1 Antibody (H00026108-M13)

Discover related pathways, diseases and genes to Pygopus-1 Antibody (H00026108-M13). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Pygopus-1 Antibody (H00026108-M13)

Discover more about diseases related to Pygopus-1 Antibody (H00026108-M13).
 

Pathways for Pygopus-1 Antibody (H00026108-M13)

View related products by pathway.

PTMs for Pygopus-1 Antibody (H00026108-M13)

Learn more about PTMs related to Pygopus-1 Antibody (H00026108-M13).

Blogs on Pygopus-1

There are no specific blogs for Pygopus-1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Pygopus-1 Antibody (3E1) and receive a gift card or discount.

Bioinformatics

Gene Symbol PYGO1
Entrez
Uniprot