Pygopus-1 Antibody (3E1)

Images

 
Western Blot: Pygopus-1 Antibody (3E1) [H00026108-M13] - Analysis of PYGO1 expression in transfected 293T cell line by PYGO1 monoclonal antibody (M13), clone 3E1. Lane 1: PYGO1 transfected lysate (Predicted MW: 46.09 ...read more
Sandwich ELISA: Pygopus-1 Antibody (3E1) [H00026108-M13] - Detection limit for recombinant GST tagged PYGO1 is 0.1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
3E1
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Pygopus-1 Antibody (3E1) Summary

Immunogen
PYGO1 (NP_056432, 101 a.a. ~ 200 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. YSTFRMPPHVPPRMSSPYCGPYSLRNQPHPFPQNPLGMGFNRPHAFNFGPHDNSSFGNPSYNNALSQNVNMPNQHFRQNPAENFSQIPPQNASQVSNPDL
Specificity
PYGO1 - pygopus homolog 1 (Drosophila) (3E1)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PYGO1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Pygopus-1 Antibody (3E1)

  • DKFZp547G0910
  • Pygo1
  • pygopus 1
  • pygopus homolog 1 (Drosophila)
  • pygopus homolog 1
  • Pygopus1
  • Pygopus-1
  • pygopus-like protein 1

Background

PYGO1, also known as Pygopus homolog 1, is a 45kDa 419 amino acid protein. PYGO1 is involved in signal transduction through the Wnt pathway. Current research on PYGO1 is being conducted in relation to acute diarrhea and colorectal cancer. PYGO1 is linked to the WTN signaling pathway where it interacts with BCL9, LENG8, CTNNB1, SPTBN1 and GRB2.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Pygopus-1 Antibody (H00026108-M13) (0)

There are no publications for Pygopus-1 Antibody (H00026108-M13).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Pygopus-1 Antibody (H00026108-M13) (0)

There are no reviews for Pygopus-1 Antibody (H00026108-M13). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Pygopus-1 Antibody (H00026108-M13) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Pygopus-1 Antibody (3E1) and receive a gift card or discount.

Bioinformatics

Gene Symbol PYGO1
Entrez
Uniprot