Home » Pygopus-1 » Pygopus-1 Antibodies » Pygopus-1 Antibody (3E1)

Pygopus-1 Antibody (3E1)

 Submit a Review

Images

 
(
Enlarge)
Western Blot: Pygopus-1 Antibody (3E1) [H00026108-M13] - Analysis of PYGO1 expression in transfected 293T cell line by PYGO1 monoclonal antibody (M13), clone 3E1. Lane 1: PYGO1 transfected lysate (Predicted MW: 46.09 KDa). Lane 2: Non-transfected lysate.
Western Blot: Pygopus-1 Antibody (3E1) [H00026108-M13] - Analysis of PYGO1 expression in transfected 293T cell line by PYGO1 monoclonal antibody (M13), clone 3E1. Lane 1: PYGO1 transfected lysate (Predicted MW: 46.09 ...read more
Sandwich ELISA: Pygopus-1 Antibody (3E1) [H00026108-M13] - Detection limit for recombinant GST tagged PYGO1 is 0.1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, S-ELISA
Clone
3E1
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

Pygopus-1 Antibody (3E1) Summary

Immunogen
PYGO1 (NP_056432, 101 a.a. ~ 200 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. YSTFRMPPHVPPRMSSPYCGPYSLRNQPHPFPQNPLGMGFNRPHAFNFGPHDNSSFGNPSYNNALSQNVNMPNQHFRQNPAENFSQIPPQNASQVSNPDL
Specificity
PYGO1 - pygopus homolog 1 (Drosophila) (3E1)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PYGO1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Sandwich ELISA
Application Notes
Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Pygopus-1 Antibody (3E1)

  • DKFZp547G0910
  • Pygo1
  • pygopus 1
  • pygopus homolog 1 (Drosophila)
  • pygopus homolog 1
  • Pygopus1
  • Pygopus-1
  • pygopus-like protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Pygopus-2 Antibody
NBP1-46171
Western Blot: Pygopus-2 Antibody [NBP1-46171] - Whole cell lysate from HeLa (5, 15 and 50 mcg for WB; 1 mg for IP, 20% of IP loaded), 293T (T; 50 mcg), and mouse NIH3T3 (M; 50 mcg) cells. Affinity purified rabbit anti-Pygo2 antibody used for WB at 0.04 mcg/ml (A) and 0.4 mcg/ml (B) and used for IP at 3 mcg/mg lysate. Pygo2 was also immunoprecipitated by rabbit anti-Pygo2 antibody NBP1-46172, which recognizes a downstream epitope.
Immunohistochemistry-Paraffin: Pygopus-2 Antibody [NBP1-46171] - Section of human breast carcinoma. Antibody: Affinity purified rabbit anti-Pygo2 used at a dilution of 1:200 (1ug/ml) Detection: DAB
(3 Publications)
Species: Hu, Mu, Ze
Applications: WB, ChIP, IHC, IHC-P, IP
Bcl-9 Antibody
NBP2-30472
Immunocytochemistry/Immunofluorescence: Bcl-9 Antibody [NBP2-30472] - Staining of human cell line SH-SY5Y shows localization to nucleoplasm & nuclear bodies. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Bcl-9 Antibody [NBP2-30472] - Staining of human testis shows moderate nuclear positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: Bcl-9 Antibody [NBP2-30472] - Analysis in human fallopian tube and pancreas tissues. Corresponding BCL9 RNA-seq data are presented for the same tissues.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
beta-Catenin
Antibody (12F7)
NBP1-54467
Western Blot: beta-Catenin Antibody (12F7) [NBP1-54467] - Total protein from human HepG2 and HeLa cells, rat PC12 cells and mouse 3T3 cells was separated on a 7.5% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 1.0 ug/ml anti-Beta catenin in 1% non-fat milk in TBST and detected with an anti-mouse HRP secondary antibody using chemiluminescence.
Western Blot: beta-Catenin Antibody (12F7) [NBP1-54467] - Activity of Wnt/beta-catenin pathway in the embryonic chick lung. Western blot analysis of active and total beta-catenin in stage b1, b2 and b3 lungs, and stage 24 limb (as positive control). Control loading was performed using beta-tubulin (55 kDa). Total and active beta-catenin correspond to 92 kDa. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pone.0112388), licensed under a CC-BY licence.
Immunocytochemistry/Immunofluorescence: beta-Catenin Antibody (12F7) [NBP1-54467] - The beta- Catenin antibody was tested in MCF-7 cells against Dylight 488 (Green). Actin and nuclei were counterstained against Phalloidin 550 (Red) and DAPI (Blue).
(4 Reviews)
(12 Publications)
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
HNF-4 alpha/NR2A1
Antibody
NBP1-89679
Western Blot: HNF-4 alpha/NR2A1 Antibody [NBP1-89679] - Analysis in human cell lines Caco-2 and PC-3 using anti-HNF4A antibody. Corresponding HNF4A RNA-seq data are presented for the same cell lines. Loading control: anti-GAPDH.
Immunocytochemistry/Immunofluorescence: HNF-4 alpha/NR2A1 Antibody [NBP1-89679] - Staining of human cell line CACO-2 shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Frozen: HNF-4 alpha/NR2A1 Antibody [NBP1-89679] - Frozen 8 um rat liver tissue section fixed in formalin. HNF-4 alpha antibody at 1:100 (green). Multiplexed with a myeloperoxidase antibody (red). DAPI staining in blue. IHC-Fr image submitted by a verified customer review.
(1 Review)
(4 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
BCL9-2 Antibody
NBP2-14350
Western Blot: BCL9-2 Antibody [NBP2-14350] - Analysis in human cell lines A-549 and HEK293 using anti-BCL9L antibody. Corresponding BCL9L RNA-seq data are presented for the same cell lines. Loading control: anti-HDAC1.
Immunocytochemistry/Immunofluorescence: BCL9-2 Antibody [NBP2-14350] - Staining of human cell line CACO-2 shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: BCL9-2 Antibody [NBP2-14350] - Staining of human liver shows no positivity in hepatocytes as expected.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
beta-Catenin
Antibody (12F7)
NBP1-54467
Western Blot: beta-Catenin Antibody (12F7) [NBP1-54467] - Total protein from human HepG2 and HeLa cells, rat PC12 cells and mouse 3T3 cells was separated on a 7.5% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 1.0 ug/ml anti-Beta catenin in 1% non-fat milk in TBST and detected with an anti-mouse HRP secondary antibody using chemiluminescence.
Western Blot: beta-Catenin Antibody (12F7) [NBP1-54467] - Activity of Wnt/beta-catenin pathway in the embryonic chick lung. Western blot analysis of active and total beta-catenin in stage b1, b2 and b3 lungs, and stage 24 limb (as positive control). Control loading was performed using beta-tubulin (55 kDa). Total and active beta-catenin correspond to 92 kDa. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pone.0112388), licensed under a CC-BY licence.
Immunocytochemistry/Immunofluorescence: beta-Catenin Antibody (12F7) [NBP1-54467] - The beta- Catenin antibody was tested in MCF-7 cells against Dylight 488 (Green). Actin and nuclei were counterstained against Phalloidin 550 (Red) and DAPI (Blue).
(4 Reviews)
(12 Publications)
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
Wnt-1 Antibody
(10C8)
NBP1-51575
Western Blot: Wnt-1 Antibody (10C8) [NBP1-51575] - Analysis using WNT1 mouse mAb against NIH/3T3 (1), 3T3L1 (2) and Hela (3) cell lysate.
Immunocytochemistry/Immunofluorescence: Wnt-1 Antibody (10C8) [NBP1-51575] - Confocal immunofluorescence analysis of Hela (left) and 3T3-L1 (right) cells using WNT1 mouse mAb (green). Red: Actin filaments have been labeled with DY-554 phalloidin. Blue: DRAQ5 fluorescent DNA dye.
Immunohistochemistry-Paraffin: Wnt-1 Antibody (10C8) [NBP1-51575] - Analysis of human LAdrenal tissues using WNT1 mouse mAb.
(1 Publication)
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
c-Myc Antibody
(9E10)
NB600-302
Western Blot: c-Myc Antibody (9E10) [NB600-302] - CtIP is phosphorylated by CDKs at multiple sites. Myc-BRCA1 and/or HA-CtIP WT or indicated mutants were expressed in 293T cells and co-immunoprecipitation was performed. Image collected and cropped by CiteAb from the following publication (//doi.org/10.1371/journal.pgen.1003277) licensed under a CC-BY licence.
Immunohistochemistry-Paraffin: c-Myc Antibody (9E10) [NB600-302] - c-Myc was detected in immersion fixed paraffin-embedded sections of human breast cancer using anti-human mouse monoclonal antibody (Catalog # NB600-302, clone 9E10) at 1:50 dilution overnight at 4 C. Tissue was stained using the VisuCyte anti-mouse HRP polymer detection reagent (Catalog # VC001) with DAB chromogen (brown) and counterstained with hematoxylin (blue). Images may not be copied, printed or otherwise disseminated without express written permission of Novus Biologicals a bio-techne brand.
Simple Western: c-Myc Antibody (9E10) [NB600-302] - Simple Western lane view shows a specific band for c-Myc in 0.5 mg/ml of Jurkat lysate. This experiment as performed under reducing conditions using the 12-230 kDa separation system.
(4 Reviews)
(33 Publications)
Species: Hu, Mu, Bv, Dr
Applications: WB, Simple Western, ChIP, ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, S-ELISA, Flow-IC
Recombinant Rat
FGF18 Protein
NBP2-35296
SDS-Page: Rat FGF18 Protein [NBP2-35296]
(1 Publication)
Species: Rt
LEF1 Antibody (3H5)
H00051176-M01
Western Blot: LEF1 Antibody (3H5) [H00051176-M01] - LEF1 monoclonal antibody (M01), clone 3H5 Analysis of LEF1 expression in MES-SA/Dx5.
Western Blot: LEF1 Antibody (3H5) [H00051176-M01] - Analysis of LEF1 over-expressed 293 cell line, cotransfected with LEF1 Validated Chimera RNAi ( Cat # H00051176-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with LEF1 monoclonal antibody (M01), clone 3H5 (Cat # H00051176-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Western Blot: LEF1 Antibody (3H5) [H00051176-M01] - LEF1 monoclonal antibody (M01), clone 3H5. Analysis of LEF1 expression in HL-60.
(3 Publications)
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, PLA, RNAi, S-ELISA
Axin-1 Antibody
AF3287
Western blot shows lysates of Raji human Burkitt's lymphoma cell line, Balb/3T3 mouse embryonic fibroblast cell line, and PC‑12 rat adrenal pheochromocytoma cell line. PVDF membrane was probed with 0.5 µg/mL of Human/Mouse/Rat Axin‑1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3287) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for Axin-1 at approximately 120 kDa (as indicated). This experiment was conducted using Immunoblot Buffer Group 1.
(1 Review)
(7 Publications)
Species: Hu, Mu, Rt
Applications: WB
Recombinant Human
FGF-13 Protein
NBP2-35009
SDS-Page: Human FGF-13 Protein [NBP2-35009]
(2 Publications)
Species: Hu
FGF-8
[Unconjugated]
423-F8/CF
1 μg/lane of Recombinant Human/Mouse FGF-8b was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 23 kDa.
Recombinant Human/Mouse FGF-8b (Catalog # 423-F8/CF) stimulates cell proliferation in the NR6R‑3T3 mouse fibroblast cell line. The ED50 for this effect is 6.5-40 ng/mL in the presence of 1 μg/mL heparin.
(44 Publications)
Species: Hu, Mu
HDAC1 Antibody
NB100-56340
Knockout Validated: HDAC1 Antibody [NB100-56340] - Western blot shows lysates of HeLa human cervical epithelial carcinoma parental cell line and HDAC1 knockout (KO) HeLa cell line. PVDF membrane was probed with 2.0 ug/ml of Rabbit Anti-Human HDAC1 Polyclonal Antibody (Catalog # NB100-56340) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog #HAF008). Specific band was detected for HDAC1 at approximately 65 kDa (as indicated) in the parental HeLa cell line, but is not detectable in the knockout HeLa cell line. This experiment was conducted under reducing conditions.
Western Blot: HDAC1 Antibody [NB100-56340] - Analysis of HDAC1 in HEK293 cell lysate with this antibody.
Immunohistochemistry-Paraffin: HDAC1 Antibody [NB100-56340] - Human testis using HDAC1 antibody at 1:250 on a Bond Rx autostainer (Leica Biosystems). The assay involved 20 minutes of heat induced antigen retrieval (HIER) using 10mM sodium citrate buffer (pH 6.0) and endogenous peroxidase quenching with peroxide block. The sections were incubated with primary antibody for 30 minutes and Bond Polymer Refine Detection (Leica Biosystems) with DAB was used for signal development followed by counterstaining with hematoxylin. Whole slide scanning and capturing of representative images was performed using Aperio AT2 (Leica Biosystems). Staining was performed by Histowiz.
(2 Reviews)
(13 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P, KO
Histone H3
[Trimethyl Lys9] Anti ...
NBP1-30141
Western Blot: Histone H3 [Trimethyl Lys9] Antibody (6F12-H4) [NBP1-30141] - Whole cell protein from human HeLa, A431, mouse Neuro2A and rat PC12 cells was separated on a 4-20% gel by SDS-PAGE, transferred to 0.2 um PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 1.0 ug/ml anti-Histone h3 in block buffer and detected with an anti-mouse HRP secondary antibody using chemiluminescence. Observed molecular weight is ~15 kDa.
Immunohistochemistry-Paraffin: Histone H3 [Trimethyl Lys9] Antibody (6F12-H4) [NBP1-30141] - Histone 3 was detected in immersion fixed paraffin-embedded sections of human colon cancer using anti-human mouse monoclonal antibody (Catalog # NBP1-30141) at 1:1000 dilution overnight at 4C. Tissue was stained using the VisuCyte anti-mouse HRP polymer detection reagent (Catalog # VC001) with DAB chromogen (brown) and counterstained with hematoxylin (blue). Images may not be copied, printed or otherwise disseminated without express written permission of Novus Biologicals a bio-techne brand.
Immunocytochemistry/Immunofluorescence: Histone H3 [Trimethyl Lys9] Antibody (6F12-H4) [NBP1-30141] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.5% Triton X-100. The cells were incubated with anti-Histone H3 [Trymethyl Lys9] (6F12-H4) at 2 ug/ml overnight at 4C and detected with an anti-mouse DyLight 488 (green) at a 1:500 dilution. Nuclei were counterstained with DAPI (blue). Cells were imaged using a 40X objective.
(1 Review)
(19 Publications)
Species: Hu, Mu, Rt, Po, Ce, Dr, In, Ma, Ye
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP
beta-TrCP1/BTRC
Antibody (4C5D8)
NBP2-61712
Western Blot: beta-TrCP1/BTRC Antibody (4C5D8) [NBP2-61712] - Analysis using BTRC mAb against HEK293 (1) and BTRC (AA: 24-151)-hIgGFc transfected HEK293 (2) cell lysate.
Immunohistochemistry: beta-TrCP1/BTRC Antibody (4C5D8) [NBP2-61712] - Analysis of paraffin-embedded rectum cancer tissues using BTRC mouse mAb with DAB staining.
Flow Cytometry: beta-TrCP1/BTRC Antibody (4C5D8) [NBP2-61712] - Analysis of Hela cells using BTRC mouse mAb (green) and negative control (red).
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P
Plectin Antibody
NBP1-84019
Immunocytochemistry/Immunofluorescence: Plectin Antibody [NBP1-84019] - Staining of human cell line U-251 MG shows localization to cytosol, intermediate filaments and focal adhesion sites. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Plectin Antibody [NBP1-84019] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: Plectin Antibody [NBP1-84019] - Staining of human pancreas shows low expression as expected.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
FGF-20
[Unconjugated]
2547-FG/CF
FGF-20 [Unconjugated]
(5 Publications)
Species: Hu
Exostosin 1
Antibody
NBP1-91875
Immunohistochemistry-Paraffin: Exostosin 1 Antibody [NBP1-91875] - Staining of human prostate shows moderate cytoplasmic positivity in smooth muscle cells.
Immunohistochemistry-Paraffin: Exostosin 1 Antibody [NBP1-91875] - Staining of human rectum shows strong membranous and cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: Exostosin 1 Antibody [NBP1-91875] - Staining of human liver shows moderate cytoplasmic positivity in hepatocytes.
(1 Publication)
Species: Hu, Mu
Applications: IHC, IHC-P
Pygopus-1 Antibody
(3E1)
H00026108-M13
Pygopus-1 Antibody (3E1)
Species: Hu
Applications: WB, ELISA, S-ELISA

Publications for Pygopus-1 Antibody (H00026108-M13) (0)

There are no publications for Pygopus-1 Antibody (H00026108-M13).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Pygopus-1 Antibody (H00026108-M13) (0)

There are no reviews for Pygopus-1 Antibody (H00026108-M13). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Pygopus-1 Antibody (H00026108-M13) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional Pygopus-1 Products

Bioinformatics Tool for Pygopus-1 Antibody (H00026108-M13)

Discover related pathways, diseases and genes to Pygopus-1 Antibody (H00026108-M13). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Pygopus-1 Antibody (H00026108-M13)

Discover more about diseases related to Pygopus-1 Antibody (H00026108-M13).
 

Pathways for Pygopus-1 Antibody (H00026108-M13)

View related products by pathway.

PTMs for Pygopus-1 Antibody (H00026108-M13)

Learn more about PTMs related to Pygopus-1 Antibody (H00026108-M13).

Blogs on Pygopus-1

There are no specific blogs for Pygopus-1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Pygopus-1 Antibody (3E1) and receive a gift card or discount.


Bioinformatics

Gene Symbol PYGO1
Entrez
Uniprot