PXMP4 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: PXMP4 Antibody [NBP2-14703] - Staining of human cell line CACO-2 shows localization to nucleoli fibrillar center & peroxisomes.
Immunohistochemistry-Paraffin: PXMP4 Antibody [NBP2-14703] - Staining of human lung shows cytoplasmic positivity in pneumocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PXMP4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: FEYHRSTLQPSLQSSMTYLYEDSNVWHDISDFLVYNKSRPSN
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PXMP4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PXMP4 Protein (NBP2-14703PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (86%), Rat (88%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PXMP4 Antibody

  • PMP24
  • PXMP4 peroxisomal membrane protein 4, 24kDa

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-59704
Species: Hu
Applications: WB
NBP1-32925
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P
NB100-53791
Species: Hu, Mu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBL1-15012
Species: Hu
NBP2-52582
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
NBP1-81776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85828
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB400-144
Species: Hu, Mu, Rt, Po, Bv, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-92298
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33908
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00007071-M15
Species: Hu, Mu, Rt
Applications: WB, ELISA
AF1227
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP1-87959
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-22568
Species: Hu
Applications: IHC-P
NB110-99585
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ICC/IF
H00008462-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-14703
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for PXMP4 Antibody (NBP2-14703) (0)

There are no publications for PXMP4 Antibody (NBP2-14703).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PXMP4 Antibody (NBP2-14703) (0)

There are no reviews for PXMP4 Antibody (NBP2-14703). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for PXMP4 Antibody (NBP2-14703) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PXMP4 Products

PXMP4 NBP2-14703

Bioinformatics Tool for PXMP4 Antibody (NBP2-14703)

Discover related pathways, diseases and genes to PXMP4 Antibody (NBP2-14703). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PXMP4 Antibody (NBP2-14703)

Discover more about diseases related to PXMP4 Antibody (NBP2-14703).
 

Pathways for PXMP4 Antibody (NBP2-14703)

View related products by pathway.

PTMs for PXMP4 Antibody (NBP2-14703)

Learn more about PTMs related to PXMP4 Antibody (NBP2-14703).

Blogs on PXMP4

There are no specific blogs for PXMP4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PXMP4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PXMP4