PXK Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: PXK Antibody [NBP1-83663] - Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane, cytosol & microtubule organizing center.
Immunohistochemistry-Paraffin: PXK Antibody [NBP1-83663] - Staining of human lateral ventricle shows strong cytoplasmic and nucleolar positivity in neuronal cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PXK Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LSLPLPPKKLIGNMDREFIAERQKGLQNYLNVITTNHILSNCELVKKFLDPNNYSANYTEIALQQVSMFFRSEPKWEVVEPLKDIGWRIRKKYFLMKIKNQPKERLVLSWADLGPDKYLSDKDFQCLIKLLP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PXK
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PXK Protein (NBP1-83663PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PXK Antibody

  • FLJ20335
  • K-ATPase long form
  • K-ATPase
  • modulator of Na
  • MONaKA
  • PX domain containing serine/threonine kinase
  • PX domain-containing protein kinase-like protein
  • PX ser/thr kinase v2
  • PX serine/threonine kinase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-89474
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-18933
Species: Hu, Mu
Applications: WB, IP
NBP2-00851
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF8005
Species: Hu
Applications: WB
NB100-1092
Species: Hu
Applications: WB, ChIP, Flow, PEP-ELISA
MAB3428
Species: Hu
Applications: WB, IHC
NB100-56326
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00007297-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
H00000640-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow
NB500-519
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IP
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
MAB195
Species: Hu
Applications: Flow, IHC, CyTOF-ready
NB110-53818
Species: Hu, Mu, Rt, Po, Bv, Pm, Xp, Ze
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, PLA
NBP1-91235
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IF
MAB5519
Species: Mu
Applications: Flow, CyTOF-ready, ICC
MAB2555
Species: Mu
Applications: WB, Flow, CyTOF-ready
NB100-56699
Species: Hu, Mu, Rt
Applications: WB, IP
AF1875
Species: Hu
Applications: WB, Flow, Block, CyTOF-ready
NBP1-77533
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC-P, IP, CyTOF-ready
NBP1-83663
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for PXK Antibody (NBP1-83663) (0)

There are no publications for PXK Antibody (NBP1-83663).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PXK Antibody (NBP1-83663) (0)

There are no reviews for PXK Antibody (NBP1-83663). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for PXK Antibody (NBP1-83663) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PXK Products

Bioinformatics Tool for PXK Antibody (NBP1-83663)

Discover related pathways, diseases and genes to PXK Antibody (NBP1-83663). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PXK Antibody (NBP1-83663)

Discover more about diseases related to PXK Antibody (NBP1-83663).
 

Pathways for PXK Antibody (NBP1-83663)

View related products by pathway.

PTMs for PXK Antibody (NBP1-83663)

Learn more about PTMs related to PXK Antibody (NBP1-83663).
 

Research Areas for PXK Antibody (NBP1-83663)

Find related products by research area.

Blogs on PXK

There are no specific blogs for PXK, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PXK Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PXK