XKR6 Antibody

Images

 
Western Blot: XKR6 Antibody [NBP2-68822] - Analysis in human cell line RT-4.
Immunocytochemistry/ Immunofluorescence: XKR6 Antibody [NBP2-68822] - Staining of human cell line RT4 shows localization to actin filaments.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

XKR6 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: FVDRRLRRTINILQYVTPTAVGIRYRDGPLLYELLQYESSL
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
XKR6
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
Application Notes
Recommended conditions: Fixation/Permeabilization: PFA/Triton X-100
Control Peptide
XKR6 Recombinant Protein Antigen (NBP2-68822PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Protein A purified

Alternate Names for XKR6 Antibody

  • C8orf5
  • C8orf7
  • FLJ31557
  • Transmembrane protein C8orf5
  • X Kell blood group precursor-related family, member 6
  • XK, Kell blood group complex subunit-related family, member 6
  • XK-related protein 6
  • XRG6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1092
Species: Hu, Mu
Applications: ChIP, Flow, PEP-ELISA, WB
NBP1-88714
Species: Hu
Applications: IHC, IHC-P
AF4084
Species: Hu
Applications: CyTOF-ready, IHC, ICFlow, WB
AF3206
Species: Hu, Mu, Rt
Applications: ICC, Simple Western, WB
7268-CT
Species: Hu
Applications: BA
NB100-56326
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-77533
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
E2-640
Species: Hu
Applications: EnzAct
NB110-53818
Species: Al, Bv, Dr, Fi, Gp, Hu, Mu, Po, Pm, Rt, Xp, Ze
Applications: EM, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP, KD, KO, PLA, RIA, Simple Western, WB
MAB3428
Species: Hu
Applications: IHC, WB
NBP1-18933
Species: Hu, Mu
Applications: IP, WB
NBP2-67868
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-83663
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-1481
Species: Hu
Applications: PEP-ELISA, WB
MAB3481
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, Neut
MAB10541
Species: Hu
Applications: CyTOF-ready, Flow, ICC, Neut
NBP2-29617
Species: Hu
Applications: IHC, IHC-Fr, IHC-P, WB
NB110-89474
Species: Bv, Ce, ChHa, Hu, Pm, Mu, Rt, RM
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, ISH, Simple Western, Single-Cell Western, WB

Publications for XKR6 Antibody (NBP2-68822) (0)

There are no publications for XKR6 Antibody (NBP2-68822).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for XKR6 Antibody (NBP2-68822) (0)

There are no reviews for XKR6 Antibody (NBP2-68822). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for XKR6 Antibody (NBP2-68822) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional XKR6 Products

Array NBP2-68822

Bioinformatics Tool for XKR6 Antibody (NBP2-68822)

Discover related pathways, diseases and genes to XKR6 Antibody (NBP2-68822). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for XKR6 Antibody (NBP2-68822)

Discover more about diseases related to XKR6 Antibody (NBP2-68822).
 

Pathways for XKR6 Antibody (NBP2-68822)

View related products by pathway.

Blogs on XKR6

There are no specific blogs for XKR6, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our XKR6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol XKR6