Recombinant Human PUM2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human PUM2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 701-798 of Human PUM2 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:DIMPSGRSRLLEDFRNNRFPNLQLRDLIGHIVEFSQDQHGSRFIQQKLERATPAERQMVFNEILQAAYQLMTDVFGNYVIQKFFEFGSLDQKLALATR

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
PUM2

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PUM2 Protein

  • FLJ36528
  • KIAA0235PUMH2PUML2
  • MGC138251
  • MGC138253
  • PUM2
  • PUMH2
  • pumilio (Drosphila) homolog 2
  • pumilio homolog 2 (Drosophila)
  • pumilio homolog 2
  • Pumilio-2
  • PUML2

Background

PUM2 - pumilio homolog 2 (Drosophila)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2437
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NB100-259
Species: Hu, Mu
Applications: WB, GS, IP
H00004831-M06
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P
NB120-22711
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-56511
Species: Hu, Mu, Rt, Fe
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
H00064506-D01P
Species: Hu, Mu
Applications: WB, ELISA
NBP2-27084
Species: Hu, Pm
Applications: WB, IHC-P
NBP2-46582
Species: Hu
Applications: WB, IHC
AF2030
Species: Hu
Applications: WB, IHC
NBP2-22449
Species: Hu, Mu, Rt, Fe, GP, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, GS
NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
NB100-1759
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB6000
Species: Hu
Applications: ICC/IF (-), WB, Flow, IHC, CyTOF-ready
NBP2-14243
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-02105
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-90095
Species: Hu
Applications: IHC, IHC-P

Publications for PUM2 Partial Recombinant Protein (H00023369-Q01) (0)

There are no publications for PUM2 Partial Recombinant Protein (H00023369-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PUM2 Partial Recombinant Protein (H00023369-Q01) (0)

There are no reviews for PUM2 Partial Recombinant Protein (H00023369-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PUM2 Partial Recombinant Protein (H00023369-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PUM2 Products

Bioinformatics Tool for PUM2 Partial Recombinant Protein (H00023369-Q01)

Discover related pathways, diseases and genes to PUM2 Partial Recombinant Protein (H00023369-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PUM2 Partial Recombinant Protein (H00023369-Q01)

Discover more about diseases related to PUM2 Partial Recombinant Protein (H00023369-Q01).
 

Pathways for PUM2 Partial Recombinant Protein (H00023369-Q01)

View related products by pathway.

PTMs for PUM2 Partial Recombinant Protein (H00023369-Q01)

Learn more about PTMs related to PUM2 Partial Recombinant Protein (H00023369-Q01).
 

Research Areas for PUM2 Partial Recombinant Protein (H00023369-Q01)

Find related products by research area.

Blogs on PUM2

There are no specific blogs for PUM2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

PUM2 Antibody
NB100-387
OCT4 Antibody
NB100-2379

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PUM2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PUM2
Entrez