PTPRK Recombinant Protein Antigen

Images

 
There are currently no images for PTPRK Recombinant Protein Antigen (NBP2-58338PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

PTPRK Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PTPRK.

Source: E. coli

Amino Acid Sequence: QFSAGGCTFDDGPGACDYHQDLYDDFEWVHVSAQEPHYLPPEMPQGSYMIVDSSDHDPGEKARLQLPTM

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PTPRK
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-58338.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PTPRK Recombinant Protein Antigen

  • DKFZp686C2268
  • DKFZp779N1045
  • EC 3.1.3.48
  • protein tyrosine phosphatase kappa , protein tyrosine phosphatase kappa
  • protein tyrosine phosphatase, receptor type, K
  • Protein-tyrosine phosphatase kappa
  • protein-tyrosine phosphatase, receptor type, kappa
  • PTPK
  • receptor type, K (R-PTP-KAPPA
  • receptor-type tyrosine-protein phosphatase kappa

Background

PTP kappa (PTPRK)is a member of the protein tyrosine phosphatase (PTP) family. The family comprises at least 37 proteins, characterized by a catalytic phosphatase domain of approximately 240 amino acids, and includes both transmembrane and cytosolic enzymes. PTP kappa is c-transmembrane PTP. The PTPs have high substrate specificity for phosphotyrosyl proteins and, at the primary sequence level, share little similarity with the protein serine phosphatases, protein threonine phosphatases, or the acid and alkaline phosphatases. PTP kappa is involved in the regulation of processes involving cell contact and adhesion, tumour invasion and metastasis. Regulation of processes involving cell contact and adhesion such as growth control. tumor invasion. and metastasis. Forms complexes with beta-catenin and gamma-catenin/plakoglobin. Beta-catenin may be a substrate for the catalytic activity of PTP-kappa.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB7475
Species: Hu, Rt
Applications: WB
AF231
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
AF1657
Species: Mu
Applications: WB
H00005250-B02P
Species: Hu
Applications: ICC/IF, WB
AF3697
Species: Hu
Applications: WB
NBP1-91258
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
236-EG
Species: Hu
Applications: BA
NBP1-47833
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
AF114
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, WB
1129-ER
Species: Hu
Applications: BA
DYC1825-2
Species: Hu, Mu, Rt
Applications: ELISA
NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, PLA, S-ELISA, Simple Western, WB
802-HC/CF
Species: Hu
Applications: BA, BA
AF4196
Species: Hu, Mu
Applications: CyTOF-ready, ICFlow, WB
NB100-1903
Species: Ca, Ha, Hu, Mu, Po, Pm, Rt
Applications: B/N, Flow, ICC/IF, IHC,  IHC-P, IP, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
AF1329
Species: Hu, Mu, Rt
Applications: ChIP, CyTOF-ready, ICC, IHC, ICFlow, Simple Western, WB
NBP2-67327
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, IP, WB
NBP2-58338PEP
Species: Hu
Applications: AC

Publications for PTPRK Recombinant Protein Antigen (NBP2-58338PEP) (0)

There are no publications for PTPRK Recombinant Protein Antigen (NBP2-58338PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PTPRK Recombinant Protein Antigen (NBP2-58338PEP) (0)

There are no reviews for PTPRK Recombinant Protein Antigen (NBP2-58338PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PTPRK Recombinant Protein Antigen (NBP2-58338PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PTPRK Products

Array NBP2-58338PEP

Research Areas for PTPRK Recombinant Protein Antigen (NBP2-58338PEP)

Find related products by research area.

Blogs on PTPRK

There are no specific blogs for PTPRK, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PTPRK Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PTPRK