PTPRH Antibody

Images

 
Western Blot: PTPRH Antibody [NBP1-69289] - This Anti-PTPRH antibody was used in Western Blot of MCF7 tissue lysate at a concentration of 1ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PTPRH Antibody Summary

Immunogen
Synthetic peptides corresponding to PTPRH(protein tyrosine phosphatase, receptor type, H) The peptide sequence was selected from the middle region of PTPRH. Peptide sequence QTKNSVMLWWKAPGDPHSQLYVYWVQWASKGHPRRGQDPQANWVNQTSRT.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PTPRH
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against PTPRH and was validated on Western blot.
Theoretical MW
120 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PTPRH Antibody

  • EC 3.1.3.48
  • FLJ39938
  • MGC133058
  • MGC133059
  • protein tyrosine phosphatase, receptor type, H
  • receptor-type tyrosine-protein phosphatase H
  • R-PTP-H
  • SAP1
  • SAP-1
  • Stomach cancer-associated protein tyrosine phosphatase 1
  • Transmembrane-type protein-tyrosine phosphatase type H

Background

PTPRH is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP possesses an extracellular region, a single transmembrane region, and a single intracytoplasmic catalytic domain, and thus represents a receptor-type PTP. The extracellular region contains eight fibronectin type III-like repeats and multiple N-glycosylation sites. It was also found to be expressed in several cancer cell lines, but not in the corresponding normal tissues.The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP possesses an extracellular region, a single transmembrane region, and a single intracytoplasmic catalytic domain, and thus represents a receptor-type PTP. The extracellular region contains eight fibronectin type III-like repeats and multiple N-glycosylation sites. The gene was shown to be expressed primarily in brain and liver, and at a lower level in heart and stomach. It was also found to be expressed in several cancer cell lines, but not in the corresponding normal tissues.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-01264
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00004068-M01
Species: Hu
Applications: WB, ELISA
AF2558
Species: Hu, Mu
Applications: WB, Simple Western
NBP2-47289
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-30646
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-33063
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87092
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00023415-R03
Species: Hu
PPS021
Species: Hu, Mu, Rt, Ca, Pm, Ze
Applications: WB
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NBP1-81257
Species: Hu
Applications: IHC, IHC-P
NB500-138
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88498
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83997
Species: Hu
Applications: WB, IHC, IHC-P
AF5588
Species: Hu, Mu
Applications: WB, IHC
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
PPS021
Species: Hu, Mu, Rt, Ca, Pm, Ze
Applications: WB
NBP1-69289
Species: Hu
Applications: WB

Publications for PTPRH Antibody (NBP1-69289) (0)

There are no publications for PTPRH Antibody (NBP1-69289).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PTPRH Antibody (NBP1-69289) (0)

There are no reviews for PTPRH Antibody (NBP1-69289). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PTPRH Antibody (NBP1-69289) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PTPRH Products

PTPRH NBP1-69289

Bioinformatics Tool for PTPRH Antibody (NBP1-69289)

Discover related pathways, diseases and genes to PTPRH Antibody (NBP1-69289). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PTPRH Antibody (NBP1-69289)

Discover more about diseases related to PTPRH Antibody (NBP1-69289).
 

Pathways for PTPRH Antibody (NBP1-69289)

View related products by pathway.

PTMs for PTPRH Antibody (NBP1-69289)

Learn more about PTMs related to PTPRH Antibody (NBP1-69289).

Blogs on PTPRH

There are no specific blogs for PTPRH, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PTPRH Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PTPRH
Uniprot