PTPRD Antibody - BSA Free

Immunohistochemistry: PTPRD Antibody [NBP2-94767] - Chronic constriction injury induces neuropathic pain and PTPRD is expressed in DRG neurons. Representative images of PTPRD co-staining with GFAP, S100 beta, or Tuj1 in DRG sections 7 days after CCI. Scale bars, 100 um. Image collected and cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/35493326/) licensed under a CC-BY license.

Western Blot: PTPRD Antibody [NBP2-94767] - Analysis of various lysates, using PTPRD Rabbit pAb at 1:500 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 180s.

Immunohistochemistry: PTPRD Antibody - BSA Free [NBP2-94767] - Protein tyrosine phosphatase receptor type D expression levels are increased in the DRG after CCI. (A) Representative images of DRG sections stained for PTPRD (red) & Tuj1 (green) in the indicated groups. Scale bars, 100 μm. (B) Western blot of PTPRD levels in ipsilateral DRGs (L4–L5) at 0, 1, 3, 7, & 14 days after CCI. Each experiment was repeated three times. (C) Quantitative analysis of data in (B). N = 3, **p 0.05. Statistical comparisons were performed by unpaired Student’s t-test (C,E). Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/35493326), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

• Reactivity: Hu, Mu
• Applications: WB, ELISA, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PTPRD Antibody - BSA Free Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 475-574 of human PTPRD (NP_002830.1). QITTIGNLVPQKTYSVKVLAFTSIGDGPLSSDIQVITQTGVPGQPLNFKAEPESETSILLSWTPPRSDTIANYELVYKDGEHGEEQRITIEPGTSYRLQG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PTPRD
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 μg/mL
  • Immunohistochemistry 1:100-1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500-1:2000
• Theoretical MW: 215 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for PTPRD Antibody - BSA Free

• HPTPDELTA
• HPTPMGC119752
• MGC119750
• MGC119751
• protein tyrosine phosphatase, receptor type, D
• Protein-tyrosine phosphatase delta
• PTP delta
• PTPD
• PTPdelta
• PTP-delta
• PTPDMGC119753
• PTPRD
• receptor type, delta polypeptide
• receptor-type tyrosine-protein phosphatase delta
• R-PTP-Delta
• RPTP-Delta

Background

The protein encoded by the PTPRD gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP contains an extracellular region, a single transmembrane segment and two tandem intracytoplasmic catalytic domains, thus represents a receptor-type PTP. The extracellular region of this protein is composed of three Ig-like and eight fibronectin type III-like domains. Studies of the similar genes in chick and fly suggest the role of this PTP is in promoting neurite growth, and regulating neurons axon guidance. Multiple tissue specific alternatively spliced transcript variants of this gene have been reported. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PTPRD Antibody (NBP2-94767)(1)

Publication using NBP2-94767

• Sun C, Wu G, Zhang Z et al. Protein Tyrosine Phosphatase Receptor Type D Regulates Neuropathic Pain After Nerve Injury via the STING-IFN-I Pathway Frontiers in Molecular Neuroscience Apr 14 2022 [PMID: 35493326] (IHC, WB, Mouse)

Bioinformatics

• Gene Symbol: PTPRD