Immunohistochemistry: PTPRD Antibody [NBP2-94767] - Chronic constriction injury induces neuropathic pain and PTPRD is expressed in DRG neurons. Representative images of PTPRD co-staining with GFAP, S100 beta, or Tuj1 in ...read more
Western Blot: PTPRD Antibody [NBP2-94767] - Analysis of various lysates, using PTPRD Rabbit pAb at 1:500 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per ...read more
Immunohistochemistry: PTPRD Antibody - BSA Free [NBP2-94767] - Protein tyrosine phosphatase receptor type D expression levels are increased in the DRG after CCI. (A) Representative images of DRG sections stained for ...read more
Protein tyrosine phosphatase receptor type D knockdown attenuates neuropathic pain following CCI. (A) Representative images of GFP (green) and NeuN staining (red) 14 days after shPTPRD injection in the DRG. Scale bar, ...read more
Recombinant fusion protein containing a sequence corresponding to amino acids 475-574 of human PTPRD (NP_002830.1). QITTIGNLVPQKTYSVKVLAFTSIGDGPLSSDIQVITQTGVPGQPLNFKAEPESETSILLSWTPPRSDTIANYELVYKDGEHGEEQRITIEPGTSYRLQG
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PTPRD
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
ELISA Recommended starting concentration is 1 μg/mL
Immunohistochemistry 1:100-1:200
Immunohistochemistry-Paraffin
Western Blot 1:500-1:2000
Theoretical MW
215 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using NBP2-94767 in the following applications:
The protein encoded by the PTPRD gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP contains an extracellular region, a single transmembrane segment and two tandem intracytoplasmic catalytic domains, thus represents a receptor-type PTP. The extracellular region of this protein is composed of three Ig-like and eight fibronectin type III-like domains. Studies of the similar genes in chick and fly suggest the role of this PTP is in promoting neurite growth, and regulating neurons axon guidance. Multiple tissue specific alternatively spliced transcript variants of this gene have been reported. (provided by RefSeq)
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our PTPRD Antibody - BSA Free and receive a gift card or discount.