PTPN4 Antibody (2C8)

Images

 
There are currently no images for PTPN4 Antibody (H00005775-M06).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
2C8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

PTPN4 Antibody (2C8) Summary

Immunogen
PTPN4 (NP_002821 361 a.a. - 460 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KPLARKLMDWEVVSRNSISDDRLETQSLPSRSPPGTPNHRNSTFTQEGTRLRPSSVGHLVDHMVHTSPSEVFVNQRSPSSTQANSIVLESSPSQETPGDG
Isotype
IgG3 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PTPN4
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
It has been used for ELISA and WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PTPN4 Antibody (2C8)

  • EC 3.1.3.48
  • MEG
  • megakaryocyte phosphatase
  • megakaryocyte protein-tyrosine phosphatase
  • protein tyrosine phosphatase MEG1
  • protein tyrosine phosphatase, non-receptor type 4 (megakaryocyte)
  • Protein-tyrosine phosphatase MEG1
  • PTPase-MEG1
  • PTPMEG
  • PTPMEG1
  • tyrosine-protein phosphatase non-receptor type 4

Background

The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This protein contains a C-terminal PTP domain and an N-terminal domain homologous to the band 4.1 superfamily of cytoskeletal-associated proteins. This PTP has been shown to interact with glutamate receptor delta 2 and epsilon subunits, and is thought to play a role in signalling downstream of the glutamate receptors through tyrosine dephosphorylation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-29518
Species: Hu, Mu, Rt
Applications: WB
MAB7475
Species: Hu, Rt
Applications: WB
H00005250-B02P
Species: Hu
Applications: WB, ICC/IF
AF4937
Species: Hu
Applications: WB, IHC
NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00002035-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-32875
Species: Hu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-16396
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF4538
Species: Hu, Mu, Rt
Applications: WB
NB110-96417
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
MAB1930
Species: Hu, Mu, Rt
Applications: WB
NBP1-83276
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-76917
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-31553
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP

Publications for PTPN4 Antibody (H00005775-M06) (0)

There are no publications for PTPN4 Antibody (H00005775-M06).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PTPN4 Antibody (H00005775-M06) (0)

There are no reviews for PTPN4 Antibody (H00005775-M06). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PTPN4 Antibody (H00005775-M06) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PTPN4 Products

Bioinformatics Tool for PTPN4 Antibody (H00005775-M06)

Discover related pathways, diseases and genes to PTPN4 Antibody (H00005775-M06). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PTPN4 Antibody (H00005775-M06)

Discover more about diseases related to PTPN4 Antibody (H00005775-M06).
 

Pathways for PTPN4 Antibody (H00005775-M06)

View related products by pathway.

PTMs for PTPN4 Antibody (H00005775-M06)

Learn more about PTMs related to PTPN4 Antibody (H00005775-M06).
 

Research Areas for PTPN4 Antibody (H00005775-M06)

Find related products by research area.

Blogs on PTPN4

There are no specific blogs for PTPN4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PTPN4 Antibody (2C8) and receive a gift card or discount.

Bioinformatics

Gene Symbol PTPN4
Uniprot