PTP4A1 Antibody

Images

 
Western Blot: PTP4A1 Antibody [H00007803-B01P] - Analysis of PTP4A1 expression in transfected 293T cell line by PTP4A1 polyclonal antibody. Lane 1: PTP4A1 transfected lysate(19.03 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

PTP4A1 Antibody Summary

Immunogen
PTP4A1 (NP_003454.1, 1 a.a. - 173 a.a.) full-length human protein. MARMNRPAPVEVTYKNMRFLITHNPTNATLNKFIEELKKYGVTTIVRVCEATYDTTLVEKEGIHVLDWPFDDGAPPSNQIVDDWLSLVKIKFREEPGCCIAVHCVAGLGRAPVLVALALIEGGMKYEDAVQFIRQKRRGAFNSKQLLYLEKYRPKMRLRFKDSNGHRNNCCIQ
Specificity
PTP4A1 - protein tyrosine phosphatase type IVA, member 1,
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
PTP4A1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PTP4A1 Antibody

  • EC 3.1.3.48
  • HH72
  • PRL1
  • PRL-1
  • PRL-1DKFZp779M0721
  • Protein tyrosine phosphatase IVA1
  • protein tyrosine phosphatase type IVA 1
  • protein tyrosine phosphatase type IVA protein 1
  • protein tyrosine phosphatase type IVA, member 1
  • Protein-tyrosine phosphatase 4a1
  • Protein-tyrosine phosphatase of regenerating liver 1
  • PTP(CAAX1)
  • PTP(CAAXI)
  • PTPCAAX1PRL1PTP(CAAX1)

Background

The protein encoded by this gene belongs to a small class of prenylated protein tyrosine phosphatases (PTPs), which contains a PTP domain and a characteristic C-terminal prenylation motif. PTPs are cell signaling molecules that play regulatory roles in a variety of cellular processes. This tyrosine phosphatase is a nuclear protein, but may primarily associate with plasma membrane. The surface membrane association of this protein depends on its C-terminal prenylation. Overexpression of this gene in mammalian cells conferred a transformed phenotype, which implicated its role in the tumorigenesis. Studies in rat suggested that this gene may be an immediate-early gene in mitogen-stimulated cells. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB3219
Species: Hu, Mu, Rt
Applications: WB
NBP2-30075
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-P
AF682
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
H00005087-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
H00001958-M03
Species: Hu, Rb
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
MAB7475
Species: Hu, Rt
Applications: WB
H00005250-B02P
Species: Hu
Applications: WB, ICC/IF
AF4937
Species: Hu
Applications: WB, IHC
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF847
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP2-00532
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-91273
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88667
Species: Hu
Applications: IHC, IHC-P
NB100-2318
Species: Hu
Applications: WB, IP
H00007803-B01P
Species: Hu
Applications: WB

Publications for PTP4A1 Antibody (H00007803-B01P) (0)

There are no publications for PTP4A1 Antibody (H00007803-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PTP4A1 Antibody (H00007803-B01P) (0)

There are no reviews for PTP4A1 Antibody (H00007803-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PTP4A1 Antibody (H00007803-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PTP4A1 Products

Bioinformatics Tool for PTP4A1 Antibody (H00007803-B01P)

Discover related pathways, diseases and genes to PTP4A1 Antibody (H00007803-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PTP4A1 Antibody (H00007803-B01P)

Discover more about diseases related to PTP4A1 Antibody (H00007803-B01P).
 

Pathways for PTP4A1 Antibody (H00007803-B01P)

View related products by pathway.

PTMs for PTP4A1 Antibody (H00007803-B01P)

Learn more about PTMs related to PTP4A1 Antibody (H00007803-B01P).

Blogs on PTP4A1

There are no specific blogs for PTP4A1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PTP4A1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PTP4A1
Entrez
Uniprot