PTMS Antibody

Images

 
Western Blot: PTMS Antibody [H00005763-D01P] - Analysis of PTMS expression in transfected 293T cell line by PTMS polyclonal antibody.Lane 1: PTMS transfected lysate(11.50 KDa).Lane 2: Non-transfected lysate.
Immunocytochemistry/ Immunofluorescence: PTMS Antibody [H00005763-D01P] - Analysis of antibody to PTMS on HeLa cell. Antibody concentration 30 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PTMS Antibody Summary

Immunogen
PTMS (NP_002815.3, 1 a.a. - 102 a.a.) full-length human protein. MSEKSVEAAAELSAKDLKEKKEKVEEKASRKERKKEVVEEEENGAEEEEEETAEDGEEEDEGEEEDEEEEEEDDEGPALKRAAEEEDEADPKRQKTENGASA
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PTMS
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Immunocytochemistry/Immunofluorescence
Application Notes
It has been used for WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PTMS Antibody

  • ParaT
  • parathymosin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-14801
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-65220
Species: Hu, Rt, Po
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
AF6429
Species: Hu
Applications: WB
NB300-731
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, B/N, Flow, GS, ICC/IF, IHC, IHC-P, IP
NB110-89456
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
AF2009
Species: Hu
Applications: WB, IHC
MAB208
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
NBP1-31470
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-616
Species: Hu, Mu, Rt, Md, Pm
Applications: WB, ChIP, EM, ICC/IF, IP, In vitro, Flow-IC
NBP1-90230
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB200-310
Species: Hu, Mu, Rt, Mk
Applications: WB, ChIP, IP, IF
NBP2-16684
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF6144
Species: Hu
Applications: WB, Simple Western
NB100-308
Species: Hu
Applications: WB, Func, ICC/IF, IP
H00005763-D01P
Species: Hu
Applications: WB, ICC/IF

Publications for PTMS Antibody (H00005763-D01P) (0)

There are no publications for PTMS Antibody (H00005763-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PTMS Antibody (H00005763-D01P) (0)

There are no reviews for PTMS Antibody (H00005763-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PTMS Antibody (H00005763-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PTMS Products

Bioinformatics Tool for PTMS Antibody (H00005763-D01P)

Discover related pathways, diseases and genes to PTMS Antibody (H00005763-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PTMS Antibody (H00005763-D01P)

Discover more about diseases related to PTMS Antibody (H00005763-D01P).
 

Pathways for PTMS Antibody (H00005763-D01P)

View related products by pathway.

PTMs for PTMS Antibody (H00005763-D01P)

Learn more about PTMs related to PTMS Antibody (H00005763-D01P).
 

Research Areas for PTMS Antibody (H00005763-D01P)

Find related products by research area.

Blogs on PTMS

There are no specific blogs for PTMS, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PTMS Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PTMS
Uniprot