PSME4 Antibody - Azide and BSA Free

Western Blot: PSME4 Antibody [NBP2-94690] - Analysis of extracts of various cell lines, using PSME4 antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit. Exposure time: 90s.

Immunohistochemistry-Paraffin: PSME4 Antibody [NBP2-94690] - Immunohistochemistry of paraffin-embedded Human esophageal using PSME4 Rabbit pAb (NBP2-94690) at dilution of 1:100 (40x lens). Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry-Paraffin: PSME4 Antibody [NBP2-94690] - Mouse heart using PSME4 Rabbit pAb at dilution of 1:100 (40x lens).

Immunohistochemistry-Paraffin: PSME4 Antibody [NBP2-94690] - Immunohistochemistry of paraffin-embedded Rat kidney using PSME4 Rabbit pAb (NBP2-94690) at dilution of 1:100 (40x lens). Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

PSME4 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Rabbit PSME4 Antibody - Azide and BSA Free (NBP2-94690) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1634-1843 of human PSME4 (NP_055429.2). LYPHQVPLVLQVLKQTARSSSWHARYTVLTYLQTMVFYNLFIFLNNEDAVKDIRWLVISLLEDEQLEVREMAATTLSGLLQCNFLTMDSPMQIHFEQLCKTKLPKKRKRDPGSVGDTIPSAELVKRHAGVLGLGACVLSSPYDVPTWMPQLLMNLSAHLNDPQPIEMTVKKTLSNFRRTHHDNWQEHKQQFTDDQLLVLTDLLVSPCYYA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PSME4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50-1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500-1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for PSME4 Antibody - Azide and BSA Free

• proteasome (prosome, macropain) activator subunit 4

Background

Proteolytic degradation is critical to the maintenance of appropriate levels of short-lived and regulatory proteins as important and diverse as those involved in cellular metabolism, heat shock and stress response, antigen presentation, modulation of cell surface receptors and ion channels, cell cycle regulation, transcription, and signalling factors. The ubiquitin-proteasome pathway deconstructs most proteins in the eukaryotic cell cytosol and nucleus. Other proteins are degraded via the vacuolar pathway which includes endosomes, lysosomes, and the endoplasmic reticulum. The 26S proteasome is an ATP-dependent, multisubunit (~31), barrel-shaped molecular machine with an apparent molecular weight of ~2.5 MDa. It consists of a 20S proteolytic core complex which is crowned at one or both ends by 19S regulatory subunit complexes. The 19S regulatory subunits recognize ubiquitinated proteins and play an essential role in unfolding and translocating targets into the lumen of the 20S subunit. The PA28/11S REG Activator protein complex functions as a proteolytic activator. PA200 has been identified as a 200 kDa nuclear protein that activates the 26S proteasome complex. Studies have shown that, in human tissues, PA200 mRNA levels are highest in testis, but is also present in liver, spleen, brain, heart, kidney and lung. Evidence suggests that this protein is involved in DNA repair, possibly by recruiting the proteasome to double-strand DNA breaks.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: PSME4