PSMC1 Antibody

Images

 
Western Blot: PSMC1 Antibody [NBP1-91476] - Lane 1: 10 ug proteasome fraction from C57B1/6J mouse brain, lane 2: 10 ug proteasome fraction from BLAB/C mouse brain. Primary PSMC1 antibody at 1:500. Secondary antibody: ...read more
Western Blot: PSMC1 Antibody [NBP1-91476] - Mouse Brain lysate, PSMC1 antibody a 1 ug/mL.
Simple Western: PSMC1 Antibody [NBP1-91476] - Mouse whole spleen lysates at the indicated concentrations were probed with a 1:25 dilution of this PSMC1 antibody. Simple Western image submitted by a verified customer ...read more

Product Details

Summary
Reactivity MuSpecies Glossary
Applications WB, Simple Western
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PSMC1 Antibody Summary

Immunogen
Synthetic peptide corresponding to a region of Mouse Psmc1 (NP_032973). Peptide sequence ELFRVAEEHAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDG.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PSMC1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
  • Simple Western
Application Notes
This PSMC1 antibody is validated for Simple Western from a verified customer review.
Theoretical MW
48 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Reviewed Applications
Read 1 Review rated 4
using
NBP1-91476 in the following applications:

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PSMC1 Antibody

  • 26S protease regulatory subunit 4
  • 26S proteasome AAA-ATPase subunit RPT2
  • MGC24583
  • P26S4
  • p56
  • proteasome (prosome, macropain) 26S subunit, ATPase, 1
  • proteasome 26S ATPase subunit 1
  • Proteasome 26S subunit ATPase 1
  • proteasome 26S subunit, ATPase, 1
  • S4MGC8541

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-01808
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow
NBP1-33691
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-38323
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB7500
Species: Hu
Applications: WB, ICC
H00006193-M02
Species: Hu, Mu, Rt, Pr
Applications: WB, ELISA, ICC/IF
NBP1-87797
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP1-87799
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-43435
Species: Hu, Mu
Applications: WB, Flow
AF3918
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
H00006201-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-87372
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37477
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
H00006202-Q01
Species: Hu
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
NBP2-58885
Species: Hu
Applications: WB, ICC/IF
NBP2-38780
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22298
Species: Hu, Mu
Applications: IP (-), WB, IHC, IHC-P

Publications for PSMC1 Antibody (NBP1-91476) (0)

There are no publications for PSMC1 Antibody (NBP1-91476).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for PSMC1 Antibody (NBP1-91476) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Mouse.

Reviews using NBP1-91476:
Filter by Applications
Simple Western
(1)
All Applications
Filter by Species
Mouse
(1)
All Species
Images Ratings Applications Species Date Details
Simple Western PSMC1 NBP1-91476
Enlarge
reviewed by:
Anonymous
Simple Western Mouse 08/23/2019
View

Summary

ApplicationSimple Western
Sample TestedMouse Spleen Lysate
SpeciesMouse
LotQC27479-40679

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PSMC1 Antibody (NBP1-91476) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional PSMC1 Products

Bioinformatics Tool for PSMC1 Antibody (NBP1-91476)

Discover related pathways, diseases and genes to PSMC1 Antibody (NBP1-91476). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PSMC1 Antibody (NBP1-91476)

Discover more about diseases related to PSMC1 Antibody (NBP1-91476).
 

Pathways for PSMC1 Antibody (NBP1-91476)

View related products by pathway.

PTMs for PSMC1 Antibody (NBP1-91476)

Learn more about PTMs related to PSMC1 Antibody (NBP1-91476).

Blogs on PSMC1

There are no specific blogs for PSMC1, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0

Anonymous
08/23/2019
Application: Simple Western
Species: Mouse

Bioinformatics

Gene Symbol PSMC1
Entrez
Uniprot
Novus 100% Guarantee