PSF2 Antibody - BSA Free

Western Blot: PSF2 Antibody [NBP1-58209] - Human Muscle lysate, concentration 0.2-1 ug/ml.

• Reactivity: Hu, Ze
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

PSF2 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to GINS2(GINS complex subunit 2 (Psf2 homolog)) The peptide sequence was selected from the N terminal of GINS2. Peptide sequence DAAEVEFLAEKELVTIIPNFSLDKIYLIGGDLGPFNPGLPVEVPLWLAIN. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GINS2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Reactivity Notes

Use in Zebrafish reported in secitific publication PMID: 32548116

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for PSF2 Antibody - BSA Free

• DNA replication complex GINS protein PSF2
• GINS complex subunit 2 (Psf2 homolog)
• GINS complex subunit 2
• HSPC037
• PSF2Pfs2

Background

The yeast heterotetrameric GINS complex is made up of Sld5, Psf1, Psf2, and Psf3. The formation of this complex is essential for the initiation of DNA replication in yeast and Xenopus egg extracts.The yeast heterotetrameric GINS complex is made up of Sld5 (GINS4; MIM 610611), Psf1 (GINS1; MIM 610608), Psf2, and Psf3 (GINS3; MIM 610610). The formation of this complex is essential for the initiation of DNA replication in yeast and Xenopus egg extracts (Ueno et al., 2005 [PubMed 16287864]). See GINS1 for additional information about the GINS complex.[supplied by OMIM].

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PSF2 Antibody (NBP1-58209)(2)

Publications using NBP1-58209

• Varga M, Csalyi K, Bertyak I et al. The GINS complex is required for the survival of rapidly proliferating retinal and tectal progenitor cells during zebrafish development bioRxiv 2020-01-01 (WB, Zebrafish)
• Varga M, Csalyi K, Bertyak I et al. Tissue-Specific Requirement for the GINS Complex During Zebrafish Development Front Cell Dev Biol 2020-05-28 [PMID: 32548116] (WB, Zebrafish)

Bioinformatics

• Gene Symbol: GINS2
• Uniprot:
  • Q9Y248(Human)