PSD-95 Recombinant Protein Antigen

Images

 
There are currently no images for PSD-95 Recombinant Protein Antigen (NBP3-25075PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

PSD-95 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PSD-95

Source: E.coli

Amino Acid Sequence: KVAKPSNAYLSDSYAPPDITTSYSQHLDNEISHSSYLGTDYPTAMTPTSPRRYSPVAKDLLGEEDIPREPRRIVIHR

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Protein/Peptide Type
Recombinant Protein Antigen
Gene
DLG4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-25075It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PSD-95 Recombinant Protein Antigen

  • discs, large homolog 4 (Drosophila)
  • disks large homolog 4
  • DLG4
  • FLJ97752
  • FLJ98574
  • Postsynaptic density protein 95
  • post-synaptic density protein 95
  • PSD95
  • PSD-95
  • PSD95SAP90SAP-90discs large homolog 4
  • SAP90
  • Synapse-associated protein 90
  • Tax interaction protein 15

Background

Post Synaptic Density 95 kDa (PSD-95), also known as synapse associated protein 90 kDa (SAP90), is one of a family of membrane-associated proteins found in the postsynaptic density in forebrain neurons and certain presynaptic structures in the cerebellum. Like other members of the family, PSD-95 has three 90 amino acid repeats called PDZ domains followed by an SH3 domain and a yeast guanylate kinase homology (GuK) domain. PSD-95 is believed to participate in the clustering of certain proteins, including NMDA receptors, Shaker-type potassium channels at the synaptic membrane in central nervous system (CNS) neurons. There are two principal modes of interaction between PSD-95 and other proteins. NMDA receptors and shaker-type potassium channels both share C-terminal sequence homology consisting of a threonine/serine-X-valine-COOH (T/SXV) motif. Other neuronal proteins that share this motif (beta 1 adrenergic receptor, some serotonin receptors, some sodium channel subunits, and additional potassium channel subunits), and some of these proteins may interact with PSD-95 by binding to its PDZ domains. Neuronal nitric oxide synthase (nNOS), which lacks the T/SXV motif but which has its own PDZ domain, has been shown to associate with PSD-95 in vitro through a pseudo-homotypic PDZ-PDZ interaction.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-556
Species: Hu, In, Mu, Pm, Rt
Applications: B/N, ChIP, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-00594
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
NB600-1229
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IP, Simple Western, WB
NBP1-85047
Species: Hu, Mu, Po, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
H00005662-B01P
Species: Hu, Rt
Applications: ICC/IF, WB
NBP2-46421
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP1-87691
Species: Hu
Applications: IHC,  IHC-P, WB
NB300-105
Species: Hu, Mu, Rb, Rt
Applications: IHC,  IHC-P, IP, KO, WB
NB300-546
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, WB
NBP1-39681
Species: Bt, Ca, Eq, Hu, Pm, Mu, Pm, Rb, Rt
Applications: ICC, IHC,  IHC-P, IP, WB
NB300-106
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IP, WB
NB300-118
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NB300-653
Species: Ch, Fe, Hu, Pm, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
DBD00
Species: Hu
Applications: ELISA
AF2685
Species: Hu
Applications: IHC, Simple Western, WB
NBP2-22399
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NBP1-88790
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-16867
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, WB
NBP1-88191
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NBP3-25075PEP
Species: Hu
Applications: AC

Publications for PSD-95 Recombinant Protein Antigen (NBP3-25075PEP) (0)

There are no publications for PSD-95 Recombinant Protein Antigen (NBP3-25075PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PSD-95 Recombinant Protein Antigen (NBP3-25075PEP) (0)

There are no reviews for PSD-95 Recombinant Protein Antigen (NBP3-25075PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PSD-95 Recombinant Protein Antigen (NBP3-25075PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PSD-95 Products

Research Areas for PSD-95 Recombinant Protein Antigen (NBP3-25075PEP)

Find related products by research area.

Blogs on PSD-95.

Losing memory: Toxicity from mutant APP and amyloid beta explain the hippocampal neuronal damage in Alzheimer's disease
 By Jamshed Arslan Pharm.D.  Alzheimer's disease (AD) is an irreversible brain disorder that destroys memory and thinking skills. The telltale signs of AD brains are extracellular deposits of amy...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PSD-95 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol DLG4