PSCA Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: PSCA Antibody [NBP2-55295] - Staining of human cell line HeLa shows localization to plasma membrane.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PSCA Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LLCYSCKAQVSNEDCLQVENCTQLGEQCWTARIRAVGLLTVISKGCSLNCVDDSQDYYVGKKNITCCDTDLCNASGAHALQPAAAILALLPALGLLLW
Specificity
Specificity of human PSCA antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PSCA
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for PSCA Antibody

  • PRO232
  • prostate stem cell antigen
  • PSCA

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87217
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IF
H00005324-M02
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-32920
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56603
Species: Hu, Mu, Pm
Applications: WB, IHC, IHC-P
NBP1-45057
Species: Hu, Mu, Rt, Po
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24557
Species: Hu, Eq, Pm
Applications: WB, IHC-P
NBP2-02541
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38530
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-53144
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb, Ye, Ze
Applications: WB, IHC
MAB943
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready
NBP1-88224
Species: Hu
Applications: WB, IHC, IHC-P
MAB4219
Species: Hu
Applications: Flow, CyTOF-ready
NBP2-46383
Species: Hu
Applications: WB, Flow, IHC
NBP1-80669
Species: Hu
Applications: IHC, IHC-P
AF4629
Species: Hu
Applications: WB

Publications for PSCA Antibody (NBP2-55295) (0)

There are no publications for PSCA Antibody (NBP2-55295).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PSCA Antibody (NBP2-55295) (0)

There are no reviews for PSCA Antibody (NBP2-55295). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for PSCA Antibody (NBP2-55295) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional PSCA Products

Bioinformatics Tool for PSCA Antibody (NBP2-55295)

Discover related pathways, diseases and genes to PSCA Antibody (NBP2-55295). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PSCA Antibody (NBP2-55295)

Discover more about diseases related to PSCA Antibody (NBP2-55295).
 

Pathways for PSCA Antibody (NBP2-55295)

View related products by pathway.

PTMs for PSCA Antibody (NBP2-55295)

Learn more about PTMs related to PSCA Antibody (NBP2-55295).
 

Research Areas for PSCA Antibody (NBP2-55295)

Find related products by research area.

Blogs on PSCA

There are no specific blogs for PSCA, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PSCA Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PSCA