PRUNE Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: PRUNE Antibody [NBP1-84055] - Staining of human cell line A-431 shows positivity in cytoplasm.

Immunohistochemistry-Paraffin: PRUNE Antibody [NBP1-84055] - Staining of human skin shows moderate cytoplasmic positivity in squamous epithelial cells.

Immunohistochemistry-Paraffin: PRUNE Antibody [NBP1-84055] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neuropil, as well as positivity in endothelial cells.

Immunohistochemistry-Paraffin: PRUNE Antibody [NBP1-84055] - Staining of human liver shows only very weak positivity in hepatocytes.

Immunohistochemistry-Paraffin: PRUNE Antibody [NBP1-84055] - Staining of human lower rectum shows moderate cytoplasmic and nuclear positivity in glandular cells.

Immunohistochemistry-Paraffin: PRUNE Antibody [NBP1-84055] - Staining of human thyroid gland shows moderate cytoplasmic positivity in glandular cells.

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG spLane 4: Human plasma (IgG/HSA depleted)Lane 5: Human liver tissueLane 6: Human tonsil tissue

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PRUNE Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LERSHSPPLKLTPASSTHPNLHAYLQGNTQVSRKKLLPLLQEALSAYFDSMKIPSGQPETADVSREQ
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PRUNE1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  PRUNE Protein (NBP1-84055PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for PRUNE Antibody - BSA Free

• BMCC1
• DRES17
• DRES-17EC 3.6.1.1
• Drosophila-related expressed sequence 17
• hPrune
• HTCD37
• KIAA0367
• protein prune homolog
• prune homolog (Drosophila)
• PRUNE2

Background

Phosphodiesterase (PDE) that has higher activity toward cAMP than cGMP, as substrate. Plays a role in cellproliferation, is able to induce cell motility and acts as a negative regulator of NME1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PRUNE1