PRUNE Antibody

Images

 
Western Blot: PRUNE Antibody [NBP1-84055] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane ...read more
Immunocytochemistry/ Immunofluorescence: PRUNE Antibody [NBP1-84055] - Staining of human cell line A-431 shows positivity in cytoplasm.
Immunohistochemistry-Paraffin: PRUNE Antibody [NBP1-84055] - Staining of human heart muscle shows moderate cytoplasmic positivity in myocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PRUNE Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LERSHSPPLKLTPASSTHPNLHAYLQGNTQVSRKKLLPLLQEALSAYFDSMKIPSGQPETADVSREQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PRUNE
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PRUNE Protein (NBP1-84055PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PRUNE Antibody

  • BMCC1
  • DRES17
  • DRES-17EC 3.6.1.1
  • Drosophila-related expressed sequence 17
  • hPrune
  • HTCD37
  • KIAA0367
  • protein prune homolog
  • prune homolog (Drosophila)
  • PRUNE2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00004830-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NBP1-89335
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85630
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC-P, IP
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB500-201
Species: Hu, Mu, Rt, Ca, Fe, GP, Ha
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF4259
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NBP2-24740
Species: Hu, Mu, Bv, Ca, Eq, Pm
Applications: WB, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-33177
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-76636
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-51843
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB500-201
Species: Hu, Mu, Rt, Ca, Fe, GP, Ha
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-215
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP1-88518
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1347
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC

Publications for PRUNE Antibody (NBP1-84055) (0)

There are no publications for PRUNE Antibody (NBP1-84055).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PRUNE Antibody (NBP1-84055) (0)

There are no reviews for PRUNE Antibody (NBP1-84055). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PRUNE Antibody (NBP1-84055) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PRUNE Products

Bioinformatics Tool for PRUNE Antibody (NBP1-84055)

Discover related pathways, diseases and genes to PRUNE Antibody (NBP1-84055). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PRUNE Antibody (NBP1-84055)

Discover more about diseases related to PRUNE Antibody (NBP1-84055).
 

Pathways for PRUNE Antibody (NBP1-84055)

View related products by pathway.

PTMs for PRUNE Antibody (NBP1-84055)

Learn more about PTMs related to PRUNE Antibody (NBP1-84055).

Blogs on PRUNE

There are no specific blogs for PRUNE, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PRUNE Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PRUNE