PRRT1 Antibody

Images

 
Immunohistochemistry-Paraffin: PRRT1 Antibody [NBP2-30641] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neuropil.
Immunohistochemistry: PRRT1 Antibody [NBP2-30641] - Staining of human stomach, upper shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry: PRRT1 Antibody [NBP2-30641] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10 Lane 2: Cerebral Cortex

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PRRT1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: PAQTAQAPGFVVPTHAGTVGTLPLGGYVAPGYPLQLQPCTAYVPVYPVGTPYAGGTPGGTGVTSTL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PRRT1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PRRT1 Protein (NBP2-30641PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PRRT1 Antibody

  • C6orf31
  • Chromosome 6 Open Reading Frame 31
  • Dispanin Subfamily D Member 1
  • DSPD1
  • IFITMD7
  • Interferon Induced Transmembrane Protein Domain Containing 7
  • NG5
  • Proline-Rich Transmembrane Protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP1-81293
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-97512
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-59448
Species: Hu
Applications: WB
NBP2-57614
Species: Hu
Applications: ICC/IF
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49365
Species: Hu
Applications: ICC/IF, IHC
NB100-2688
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-CS
NBP2-57712
Species: Hu
Applications: ICC/IF
MAB6529
Species: Hu
Applications: WB, Simple Western
NBP1-87201
Species: Hu
Applications: WB, IHC, IHC-P
AF1062
Species: Mu
Applications: WB, IHC, Neut
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-80905
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB2048
Species: Hu
Applications: WB, Flow, CyTOF-ready
NB400-151
Species: Hu, Mu, Rt
Applications: ICC/IF (-), WB
3008-WN/CF
Species: Hu
NBP2-30641
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for PRRT1 Antibody (NBP2-30641) (0)

There are no publications for PRRT1 Antibody (NBP2-30641).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PRRT1 Antibody (NBP2-30641) (0)

There are no reviews for PRRT1 Antibody (NBP2-30641). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PRRT1 Antibody (NBP2-30641) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PRRT1 Products

PRRT1 NBP2-30641

Bioinformatics Tool for PRRT1 Antibody (NBP2-30641)

Discover related pathways, diseases and genes to PRRT1 Antibody (NBP2-30641). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on PRRT1

There are no specific blogs for PRRT1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PRRT1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PRRT1
Uniprot