PRPF4 Antibody

Images

 
Western Blot: PRPF4 Antibody [NBP1-83217] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: PRPF4 Antibody [NBP1-83217] - Staining of human cell line A-431 shows localization to nuclear speckles.
Immunohistochemistry-Paraffin: PRPF4 Antibody [NBP1-83217] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.
Western Blot: PRPF4 Antibody [NBP1-83217] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG

Product Details

Summary
Reactivity Hu, Mu, Rt, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PRPF4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:ISYCHFSPNSKMLATACWSGLCKLWSVPDCNLLHTLRGHNTNVGAIVFHPKSTVSLDPKDVNLASCAADGSVKLWSLDSDEPVADIE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PRPF4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PRPF4 Protein (NBP1-83217PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PRPF4 Antibody

  • hPrp4
  • HPRP4P
  • HPRP4PRP4/STK/WD splicing factor
  • PRP4 homolog
  • PRP4 pre-mRNA processing factor 4 homolog (yeast)
  • Prp4p
  • PRP4WD splicing factor Prp4
  • U4/U6 small nuclear ribonucleoprotein Prp4
  • U4/U6 snRNP 60 kDa protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-83219
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82999
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20324
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92298
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82510
Species: Hu
Applications: WB, IHC, IHC-P
NB100-360
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB120-11012
Species: Hu, Bv(-), Ca(-), Eq(-), Gp(-), Mu(-), Po(-)
Applications: WB, ELISA, ICC/IF, IP
NBP1-92297
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-58824
Species: Hu, Mu
Applications: WB, ChIP, IP, PLA
NBP2-22273
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP1-32521
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF3589
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NBP2-32416
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87784
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2594
Species: Hu, Mu
Applications: WB, ChIP, IHC-P, IP, PLA
NB100-55245
Species: Hu
Applications: WB, IHC, IHC-P, IP
H00001195-B01P
Species: Hu
Applications: WB, ICC/IF
NBP1-32775
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
AF5540
Species: Mu
Applications: WB
NBP1-83217
Species: Hu, Mu, Rt, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for PRPF4 Antibody (NBP1-83217) (0)

There are no publications for PRPF4 Antibody (NBP1-83217).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PRPF4 Antibody (NBP1-83217) (0)

There are no reviews for PRPF4 Antibody (NBP1-83217). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PRPF4 Antibody (NBP1-83217) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PRPF4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PRPF4