We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Prox1 Recombinant Protein Antigen

Images

 
There are currently no images for Prox1 Recombinant Protein Antigen (NBP2-55222PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Prox1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Prox1.

Source: E. coli

Amino Acid Sequence: TAMSQVVDTVVKVFSAKPSRQVPQVFPPLQIPQARFAVNGENHNFHTANQRLQCFGDVIIPNPLDTFGSVQMPSSTDQTEALPLVVRKNSSEQSASGPATGGHHQPLHQSPLSATAGFTTPSFRHPF

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PROX1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55222.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Prox1 Recombinant Protein Antigen

  • Homeobox prospero-like protein PROX1
  • prospero homeobox 1
  • prospero homeobox protein 1
  • prospero-related homeobox 1
  • Prox1
  • PROX-1

Background

PROX1 may play a fundamental role in early development of CNS. May regulate gene expression and development of postmitotic undifferentiated young neurons. PROX1 antibodies are also used as a highly specific marker of lymphatic endothelial cells.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF743
Species: Mu
Applications: CyTOF-ready, Flow, WB
AF2125
Species: Mu
Applications: Dual ISH-IHC, IHC, WB
DVEC00
Species: Hu
Applications: ELISA
AF8150
Species: Hu
Applications: ICC, ICFlow, Simple Western, WB
AF3244
Species: Mu
Applications: IHC, Simple Western, WB
NBP1-89917
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
DVE00
Species: Hu
Applications: ELISA
802-HC/CF
Species: Hu
Applications: BA, BA
NBP2-27196
Species: Bv, Ca, Ch, ChHa, Eq, Gp, Hu, Mu, Ma-Op, Po, Pm, Rb, Rt, RM, Ze
Applications: IHC,  IHC-P, KD, WB
NBP2-24551
Species: Bv, Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
AF2018
Species: Hu, Mu, Rt
Applications: ChIP, ICC, IHC, Simple Western, WB
H00006496-M04
Species: Hu
Applications: ELISA, WB
NB110-58867
Species: Bv, Hu, Mu, Po, Rt
Applications: ICC/IF, WB
NB110-41083
Species: Hu
Applications: ELISA, WB
AF3628
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
NBP3-10932
Species: Hu
Applications: IHC, WB
NBP3-14738
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, IP, WB

Publications for Prox1 Recombinant Protein Antigen (NBP2-55222PEP) (0)

There are no publications for Prox1 Recombinant Protein Antigen (NBP2-55222PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Prox1 Recombinant Protein Antigen (NBP2-55222PEP) (0)

There are no reviews for Prox1 Recombinant Protein Antigen (NBP2-55222PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Prox1 Recombinant Protein Antigen (NBP2-55222PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Prox1 Products

Research Areas for Prox1 Recombinant Protein Antigen (NBP2-55222PEP)

Find related products by research area.

Blogs on Prox1.


  Read full blog post.

Podoplanin (OST8, Glycoprotein (Gp) 36 or 38, Lung Type I Cell Membrane Associated Glycoprotein)
Podoplanin is a mucin-type 1 transmembrane glycoprotein found in a wide range of tissues. It appears to be differentially expressed in endothelial cells of lymphatic but not blood vessel origin. In normal skin and kidney, podoplanin co-localizes with ...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Prox1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PROX1