Protocadherin gamma C3 Antibody (3A1)

Images

 
Sandwich ELISA: Protocadherin gamma C3 Antibody (3A1) [H00005098-M02] - Detection limit for recombinant GST tagged PCDHGC3 is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
3A1
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Protocadherin gamma C3 Antibody (3A1) Summary

Immunogen
PCDHGC3 (NP_002579, 71 a.a. - 178 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GASRRFFEVNRETGEMFVNDRLDREELCGTLPSCTVTLELVVENPLELFSVEVVIQDINDNNPAFPTQEMKLEISEAVAPGTRFPLESAHDPDVGSNSLQTYELSRNE
Specificity
PCDHGC3 (3A1)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PCDHGC3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Protocadherin gamma C3 Antibody (3A1)

  • Cadherin-Like 2
  • PC43
  • PC-43
  • PCDH2
  • PCDH-GAMMA-C3
  • PCDHGC3
  • protocadherin 2
  • Protocadherin 43
  • Protocadherin gamma C3
  • protocadherin gamma subfamily C, 3
  • protocadherin gamma-C3
  • Protocadherin-2
  • protocadherin-43

Background

This gene is a member of the protocadherin gamma gene cluster, one of three related clusters tandemly linked on chromosome five. These gene clusters have an immunoglobulin-like organization, suggesting that a novel mechanism may be involved in their regulation and expression. The gamma gene cluster includes 22 genes divided into 3 subfamilies. Subfamily A contains 12 genes, subfamily B contains 7 genes and 2 pseudogenes, and the more distantly related subfamily C contains 3 genes. The tandem array of 22 large, variable region exons are followed by a constant region, containing 3 exons shared by all genes in the cluster. Each variable region exon encodes the extracellular region, which includes 6 cadherin ectodomains and a transmembrane region. The constant region exons encode the common cytoplasmic region. These neural cadherin-like cell adhesion proteins most likely play a critical role in the establishment and function of specific cell-cell connections in the brain. Alternative splicing has been described for the gamma cluster genes. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00005097-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-02009
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-48309
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
H00026025-R01
Species: Hu
AF761
Species: Mu
Applications: WB, Simple Western, Flow, IHC, AdBlk, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-25241
Species: Hu, Mu
Applications: WB, ICC/IF, IP
NB200-109
Species: Hu, Mu
Applications: WB, ChIP, Flow, GS, ICC/IF, IP, CyTOF-ready
NBP2-15723
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-86216
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-88010
Species: Hu
Applications: IHC, IHC-P
NBP2-12553
Species: Hu
AF1444
Species: Mu
Applications: WB, IHC
NBP1-83054
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-15065
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-22187
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, IF
NBP2-25196
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, In vitro, CyTOF-ready
NBP2-13901
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-20154
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-240
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA
H00005098-M02
Species: Hu
Applications: WB, ELISA

Publications for Protocadherin gamma C3 Antibody (H00005098-M02) (0)

There are no publications for Protocadherin gamma C3 Antibody (H00005098-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Protocadherin gamma C3 Antibody (H00005098-M02) (0)

There are no reviews for Protocadherin gamma C3 Antibody (H00005098-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Protocadherin gamma C3 Antibody (H00005098-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Protocadherin gamma C3 Products

Bioinformatics Tool for Protocadherin gamma C3 Antibody (H00005098-M02)

Discover related pathways, diseases and genes to Protocadherin gamma C3 Antibody (H00005098-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Protocadherin gamma C3 Antibody (H00005098-M02)

Discover more about diseases related to Protocadherin gamma C3 Antibody (H00005098-M02).
 

Pathways for Protocadherin gamma C3 Antibody (H00005098-M02)

View related products by pathway.

PTMs for Protocadherin gamma C3 Antibody (H00005098-M02)

Learn more about PTMs related to Protocadherin gamma C3 Antibody (H00005098-M02).

Blogs on Protocadherin gamma C3

There are no specific blogs for Protocadherin gamma C3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Protocadherin gamma C3 Antibody (3A1) and receive a gift card or discount.

Bioinformatics

Gene Symbol PCDHGC3
Entrez
OMIM
Uniprot