We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Protein Phosphatase 1 beta Antibody (5O9E7)

Images

 
Western Blot: Protein Phosphatase 1 beta Antibody (5O9E7) [NBP3-16389] - Western blot analysis of extracts of various cell lines, using Protein Phosphatase 1 beta Rabbit mAb (NBP3-16389) at 1:1000 dilution. Secondary ...read more
Immunocytochemistry/ Immunofluorescence: Protein Phosphatase 1 beta Antibody (5O9E7) [NBP3-16389] - Immunofluorescence analysis of U-2 OS cells using Protein Phosphatase 1 beta Rabbit mAb (NBP3-16389) at dilution of ...read more
Immunocytochemistry/ Immunofluorescence: Protein Phosphatase 1 beta Antibody (5O9E7) [NBP3-16389] - Immunofluorescence analysis of NIH-3T3 cells using Protein Phosphatase 1 beta Rabbit mAb (NBP3-16389) at dilution of ...read more
Immunohistochemistry: Protein Phosphatase 1 beta Antibody (5O9E7) [NBP3-16389] - Immunohistochemistry analysis of Protein Phosphatase 1 beta in paraffin-embedded human pancreas tissue using Protein Phosphatase 1 beta ...read more
Immunohistochemistry: Protein Phosphatase 1 beta Antibody (5O9E7) [NBP3-16389] - Immunohistochemistry analysis of Protein Phosphatase 1 beta in paraffin-embedded mouse colon tissue using Protein Phosphatase 1 beta ...read more
Immunohistochemistry: Protein Phosphatase 1 beta Antibody (5O9E7) [NBP3-16389] - Immunohistochemistry analysis of Protein Phosphatase 1 beta in paraffin-embedded human breast cancer tissue using Protein Phosphatase 1 ...read more
Immunohistochemistry: Protein Phosphatase 1 beta Antibody (5O9E7) [NBP3-16389] - Immunohistochemistry analysis of Protein Phosphatase 1 beta in paraffin-embedded human esophagus tissue using Protein Phosphatase 1 beta ...read more
Immunohistochemistry: Protein Phosphatase 1 beta Antibody (5O9E7) [NBP3-16389] - Immunohistochemistry analysis of Protein Phosphatase 1 beta in paraffin-embedded rat colon tissue using Protein Phosphatase 1 beta Rabbit ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC
Clone
5O9E7
Clonality
Monoclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Protein Phosphatase 1 beta Antibody (5O9E7) Summary

Additional Information
Recombinant Monoclonal Antibody
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 228-327 of human Protein Phosphatase 1 beta (P62140). ADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEKKAKYQYGGLNSGRPVTPPRTANPPKKR
Source
HEK293
Isotype
IgG
Clonality
Monoclonal
Host
Rabbit
Gene
PPP1CB
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.3), 50% glycerol, 0.05% BSA
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Protein Phosphatase 1 beta Antibody (5O9E7)

  • EC 3.1.3.16
  • EC 3.1.3.53
  • MGC3672
  • PP1beta
  • PP-1Bprotein phosphatase 1, catalytic subunit, delta isoform
  • PPP1CD
  • protein phosphatase 1, catalytic subunit, beta isoform
  • protein phosphatase 1, catalytic subunit, beta isozyme
  • protein phosphatase 1-beta
  • protein phosphatase 1-delta
  • serine/threonine protein phosphatase PP1-beta catalytic subunit
  • serine/threonine-protein phosphatase PP1-beta catalytic subunit

Background

Protein phosphatase 1 (PP1) is a major eukaryotic protein serine/threonine phosphatase that regulates an enormous variety of cellular functions through the interaction of its catalytic subunit (PP1c) with over fifty different established or putative regulatory subunits (1). The coordinated and reciprocal action of serine/threonine (Ser/Thr) protein kinases and phosphatases produces transient phosphorylation, a fundamental regulatory mechanism for many biological processes. PP1 is ubiquitously distributed and regulates a broad range of cellular functions, including glycogen metabolism, cell-cycle progression and muscle relaxation. PP1 has evolved effective catalytic machinery but lacks substrate specificity. Substrate specificity is conferred upon PP1 through interactions with a large number of regulatory subunits (2). It has been shown that PP1 determines the efficacy of learning and memory by limiting acquisition and favoring memory decline. When PP1 is genetically inhibited during learning, short intervals between training episodes are sufficient for optimal performance (3).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31348
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-45384
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
AF6465
Species: Hu, Rt
Applications: ICC, WB
H00050848-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, PLA, S-ELISA, WB
NB100-1972
Species: Ba, Ca, Ch, Fi, Gp, Hu, Mu, Po, Pm, Rb, Rt, Sh
Applications: Flow-IC, Flow, ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP3-35077
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IP, WB
NB110-61646
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP2-27202
Species: Ca, Ch, ChHa, Fe, Hu, Mu, Ma-Op, Po, Pm, Rt
Applications: ICC/IF, Simple Western, WB
NBP2-03993
Species: Bv, Ca, Hu, Mu, Pm
Applications: WB
NB100-1533
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC,  IHC-P, PEP-ELISA, WB
H00054940-B01P
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NB100-2146
Species: Hu, Mu, Rt
Applications: ICC/IF, IP, WB
NB100-56745
Species: Hu, Mu
Applications: ChIP, ChIP, ICC/IF, IHC,  IHC-P, IP, WB
NB100-404
Species: Hu
Applications: ChIP, ICC/IF, IHC,  IHC-P, IP, KD, KO, WB
MAB17761
Species: Hu, Mu, Rt
Applications: ICC, WB
NBP2-02272
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, WB
H00005555-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP2-67503
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, IP, WB

Publications for Protein Phosphatase 1 beta Antibody (NBP3-16389) (0)

There are no publications for Protein Phosphatase 1 beta Antibody (NBP3-16389).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Protein Phosphatase 1 beta Antibody (NBP3-16389) (0)

There are no reviews for Protein Phosphatase 1 beta Antibody (NBP3-16389). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Protein Phosphatase 1 beta Antibody (NBP3-16389) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Protein Phosphatase 1 beta Products

Research Areas for Protein Phosphatase 1 beta Antibody (NBP3-16389)

Find related products by research area.

Blogs on Protein Phosphatase 1 beta.

Myc-tag: The "Monkey Wrench" of Proteomic Tools
c-Myc is a well-characterized transcription factor encoded by the c-Myc gene on human chromosome 8q24. This cellular proto-oncogene, also known as p62, is commonly activated in a variety of tumor cells and plays a crucial role in cellular proliferatio...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Protein Phosphatase 1 beta Antibody (5O9E7) and receive a gift card or discount.

Bioinformatics

Gene Symbol PPP1CB