Proteasome subunit beta type 4 Antibody [mFluor Violet 500 SE]

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: mFluor Violet 500 SE

Proteasome subunit beta type 4 Antibody [mFluor Violet 500 SE] Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-264 of human Proteasome subunit beta type 4 (NP_002787.2).
  
  Sequence:
  MEAFLGSRSGLWAGGPAPGQFYRIPSTPDSFMDPASALYRGPITRTQNPMVTGTSVLGVKFEGGVVIAADMLGSYGSLARFRNISRIMRVNNSTMLGASGDYADFQYLKQVLGQMVIDEELLGDGHSYSPRAIHSWLTRAMYSRRSKMNPLWNTMVIGGYADGESFLGYVDMLGVAYEAPSLATGYGAYLAQPLLREVLEKQPVLSQTEARDLVERCMRVLYYRDARSYNRFQIATVTEKGVEIEGPLSTETNWDIAHMISGFE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PSMB4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot
• Application Notes: Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

• Storage: Store at 4C in the dark.
• Buffer: 50mM Sodium Borate
• Preservative: 0.05% Sodium Azide
• Purity: Affinity purified

Notes

mFluor(TM) is a trademark of AAT Bioquest, Inc. This conjugate is made on demand. Actual recovery may vary from the stated volume of this product. The volume will be greater than or equal to the unit size stated on the datasheet.

Alternate Names for Proteasome subunit beta type 4 Antibody [mFluor Violet 500 SE]

• EC 3.4.25.1
• HN3
• HsBPROS26
• HsN3
• Macropain beta chain
• Multicatalytic endopeptidase complex beta chain
• PROS26
• PROS-26
• PROS26PROS-26
• proteasome (prosome, macropain) subunit, beta type, 4
• Proteasome beta chain
• Proteasome chain 3
• Proteasome subunit beta type 4
• proteasome subunit beta type-4
• proteasome subunit HsN3
• proteasome subunit, beta type, 4,26 kDa prosomal protein
• PSMB4

Background

The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PSMB4