Proteasome beta 1 Antibody


Western Blot: Proteasome beta 1 Antibody [NBP1-89713] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: Proteasome beta 1 Antibody [NBP1-89713] - Staining of human kidney shows distinct nuclear and cytoplasmic positivity in tubule cells.
Western Blot: Proteasome beta 1 Antibody [NBP1-89713] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

Proteasome beta 1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: SGFHGDCLTLTKIIEARLKMYKHSNNKAMTTGAIAAMLSTILYSRRFFPYYVYNIIGGLDEEGKGAVYSFDPVGS
Specificity of human, mouse, rat Proteasome beta 1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
Proteasome beta 1 Protein (NBP1-89713PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Proteasome beta 1 Antibody

  • EC
  • FLJ25321
  • HC5
  • KIAA1838
  • Macropain subunit C5
  • Multicatalytic endopeptidase complex subunit C5
  • PMSB1
  • proteasome (prosome, macropain) subunit, beta type, 1
  • proteasome beta 1 subunit
  • Proteasome component C5
  • Proteasome gamma chain
  • proteasome subunit beta type-1
  • proteasome subunit HC5
  • PSC5


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Po
Applications: WB, PEP-ELISA
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Mu, Rt
Applications: WB, Flow, IHC, CyTOF-ready
Species: Hu, Mu, Rt, Pm
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for Proteasome beta 1 Antibody (NBP1-89713) (0)

There are no publications for Proteasome beta 1 Antibody (NBP1-89713).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Proteasome beta 1 Antibody (NBP1-89713) (0)

There are no reviews for Proteasome beta 1 Antibody (NBP1-89713). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Proteasome beta 1 Antibody (NBP1-89713) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Proteasome beta 1 Products

Bioinformatics Tool for Proteasome beta 1 Antibody (NBP1-89713)

Discover related pathways, diseases and genes to Proteasome beta 1 Antibody (NBP1-89713). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Proteasome beta 1 Antibody (NBP1-89713)

Discover more about diseases related to Proteasome beta 1 Antibody (NBP1-89713).

Pathways for Proteasome beta 1 Antibody (NBP1-89713)

View related products by pathway.

PTMs for Proteasome beta 1 Antibody (NBP1-89713)

Learn more about PTMs related to Proteasome beta 1 Antibody (NBP1-89713).

Blogs on Proteasome beta 1

There are no specific blogs for Proteasome beta 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Proteasome beta 1 Antibody and receive a gift card or discount.


Gene Symbol PSMB1