Proteasome beta 1 Antibody

Images

 
Western Blot: Proteasome beta 1 Antibody [NBP1-89713] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: Proteasome beta 1 Antibody [NBP1-89713] - Staining of human kidney shows distinct nuclear and cytoplasmic positivity in tubule cells.
Western Blot: Proteasome beta 1 Antibody [NBP1-89713] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Proteasome beta 1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SGFHGDCLTLTKIIEARLKMYKHSNNKAMTTGAIAAMLSTILYSRRFFPYYVYNIIGGLDEEGKGAVYSFDPVGS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PSMB1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
Proteasome beta 1 Protein (NBP1-89713PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Proteasome beta 1 Antibody

  • EC 3.4.25.1
  • FLJ25321
  • HC5
  • KIAA1838
  • Macropain subunit C5
  • Multicatalytic endopeptidase complex subunit C5
  • PMSB1
  • proteasome (prosome, macropain) subunit, beta type, 1
  • proteasome beta 1 subunit
  • Proteasome component C5
  • Proteasome gamma chain
  • proteasome subunit beta type-1
  • proteasome subunit HC5
  • PSC5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-12933
Species: Hu, Mu, Rt, Po
Applications: WB, PEP-ELISA
NBP1-54633
Species: Hu
Applications: WB, IHC
NBP1-80819
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-86566
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-37570
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC
NBP1-88660
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01817
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-19795
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF3970
Species: Mu, Rt
Applications: WB, Flow, IHC, CyTOF-ready
NBP2-01608
Species: Hu, Mu, Rt, Pm
Applications: WB, IHC, IHC-P
NB600-1160
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB300-749
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-92293
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NBP1-69750
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF6657
Species: Hu
Applications: WB, IHC
PPS046
Species: Hu, Mu, Rt, Bv, Ca, Ch, GP, Pm, Ze
Applications: WB
MAB8634
Species: Mu
Applications: WB, Simple Western, Flow, IHC

Publications for Proteasome beta 1 Antibody (NBP1-89713) (0)

There are no publications for Proteasome beta 1 Antibody (NBP1-89713).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Proteasome beta 1 Antibody (NBP1-89713) (0)

There are no reviews for Proteasome beta 1 Antibody (NBP1-89713). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Proteasome beta 1 Antibody (NBP1-89713) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Proteasome beta 1 Products

Bioinformatics Tool for Proteasome beta 1 Antibody (NBP1-89713)

Discover related pathways, diseases and genes to Proteasome beta 1 Antibody (NBP1-89713). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Proteasome beta 1 Antibody (NBP1-89713)

Discover more about diseases related to Proteasome beta 1 Antibody (NBP1-89713).
 

Pathways for Proteasome beta 1 Antibody (NBP1-89713)

View related products by pathway.

PTMs for Proteasome beta 1 Antibody (NBP1-89713)

Learn more about PTMs related to Proteasome beta 1 Antibody (NBP1-89713).

Blogs on Proteasome beta 1

There are no specific blogs for Proteasome beta 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Proteasome beta 1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PSMB1
Entrez
Uniprot