FAM120B Antibody

Images

 
Western Blot: FAM120B Antibody [NBP1-86566] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-201
Immunohistochemistry-Paraffin: FAM120B Antibody [NBP1-86566] - Staining of human kidney shows nuclear and cytoplasmic positivity in cells in tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FAM120B Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: EVPMYTGSEPRQEVPMYTGPESRQEVPMYTGPESRQEVLIRTDPESRQEIMCTGHESKQEVPICTDPISKQEDSMCTHAEINQKLPVATDFEFKLEALMCTNPEIKQEDPTNV
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FAM120B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
FAM120B Protein (NBP1-86566PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FAM120B Antibody

  • CCPGKIAA0183
  • Constitutive coactivator of PPARG
  • Constitutive coactivator of PPAR-gamma
  • family with sequence similarity 120B
  • FLJ55614
  • KIAA1838constitutive coactivator of peroxisome proliferator-activated receptor gamma
  • PGCC1dJ894D12.1
  • PPARG constitutive coactivator 1
  • PPARgamma constitutive coactivator 1
  • Protein FAM120B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-13174
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-19795
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
5026-DL
Species: Mu
Applications: BA
NBP1-89714
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-22106
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NBP1-80819
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
MAB1144
Species: Hu
Applications: CyTOF-ready, Flow, ICC, WB
AF7829
Species: Hu
Applications: ICC, IHC, WB
NBP1-90580
Species: Hu
Applications: IHC, IHC-P
H00004854-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-75672
Species: Hu
Applications: IHC, IHC-P, IP, WB
MAB195
Species: Hu
Applications: CyTOF-ready, Flow, IHC
DRP300
Species: Hu
Applications: ELISA
NBP3-12487
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
NB120-13888
Species: Hu, Mu, Rt
Applications: ChIP, CyTOF-ready, Flow, ICC/IF, IHC-WhMt, IHC, IHC-Fr, IHC-P, WB
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB

Publications for FAM120B Antibody (NBP1-86566) (0)

There are no publications for FAM120B Antibody (NBP1-86566).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FAM120B Antibody (NBP1-86566) (0)

There are no reviews for FAM120B Antibody (NBP1-86566). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FAM120B Antibody (NBP1-86566) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FAM120B Products

Bioinformatics Tool for FAM120B Antibody (NBP1-86566)

Discover related pathways, diseases and genes to FAM120B Antibody (NBP1-86566). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FAM120B Antibody (NBP1-86566)

Discover more about diseases related to FAM120B Antibody (NBP1-86566).
 

Pathways for FAM120B Antibody (NBP1-86566)

View related products by pathway.

Research Areas for FAM120B Antibody (NBP1-86566)

Find related products by research area.

Blogs on FAM120B

There are no specific blogs for FAM120B, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FAM120B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FAM120B