Proteasome 20S beta2 Antibody

Images

 
Western Blot: Proteasome 20S beta2 Antibody [NBP1-92294] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: Proteasome 20S beta2 Antibody [NBP1-92294] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: Proteasome 20S beta2 Antibody [NBP1-92294] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.
Western Blot: Proteasome 20S beta2 Antibody [NBP1-92294] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Proteasome 20S beta2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LLLAGYDEHEGPALYYMDYLAALAKAPFAAHGYGAFLTLSILDRYYTPTISRERAVELLRKCLEELQKRFILNLPTF
Specificity
Specificity of human, mouse, rat Proteasome 20S beta2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PSMB2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Proteasome 20S beta2 Protein (NBP1-92294PEP)
Publications
Read Publication using NBP1-92294.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Proteasome 20S beta2 Antibody

  • EC 3.4.25.1
  • HC7-I
  • Macropain subunit C7-I
  • MGC104215
  • MGC126885
  • multicatalytic endopeptidase complex subunit C7-1
  • Multicatalytic endopeptidase complex subunit C7-I
  • proteasome (prosome, macropain) subunit, beta type, 2
  • proteasome beta 2 subunit
  • Proteasome component C7-I
  • proteasome subunit beta type-2
  • proteasome subunit, beta type, 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-75554
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-01817
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-13820
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88660
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33380
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-1160
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-32387
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92293
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB6529
Species: Hu
Applications: WB, Simple Western
NBP2-75606
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-30852
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-46297
Species: Hu
Applications: WB, IHC
NBP1-79517
Species: Mu
Applications: WB
NBP1-85448
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13821
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-01225
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89755
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89714
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-03836
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, IHC, IHC-P
NBP1-92294
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Proteasome 20S beta2 Antibody (NBP1-92294)(1)

Reviews for Proteasome 20S beta2 Antibody (NBP1-92294) (0)

There are no reviews for Proteasome 20S beta2 Antibody (NBP1-92294). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Proteasome 20S beta2 Antibody (NBP1-92294) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for Proteasome 20S beta2 Antibody (NBP1-92294)

Discover related pathways, diseases and genes to Proteasome 20S beta2 Antibody (NBP1-92294). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Proteasome 20S beta2 Antibody (NBP1-92294)

Discover more about diseases related to Proteasome 20S beta2 Antibody (NBP1-92294).
 

Pathways for Proteasome 20S beta2 Antibody (NBP1-92294)

View related products by pathway.

PTMs for Proteasome 20S beta2 Antibody (NBP1-92294)

Learn more about PTMs related to Proteasome 20S beta2 Antibody (NBP1-92294).

Blogs on Proteasome 20S beta2

There are no specific blogs for Proteasome 20S beta2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Proteasome 20S beta2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PSMB2