Proteasome 20S beta2 Antibody


Western Blot: Proteasome 20S beta2 Antibody [NBP1-54590] - Analysis of HepG2 cell lysate. Antibody Dilution: 1.0 ug/ml PSMB2 is supported by BioGPS gene expression data to be expressed in HepG2.
Western Blot: Proteasome 20S beta2 Antibody [NBP1-54590] - Titration: 0.2-1 ug/ml, Positive Control: Hela cell lysate.
Western Blot: Proteasome 20S beta2 Antibody [NBP1-54590] - Jurkat, Antibody Dilution: 1.0 ug/ml PSMB2 is strongly supported by BioGPS gene expression data to be expressed in Jurkat.
Western Blot: Proteasome 20S beta2 Antibody [NBP1-54590] - Titration: 2 ug/ml Positive Control: Human NT-2 cells and Mouse WT brain.

Product Details

Reactivity Hu, MuSpecies Glossary
Applications WB

Order Details

Proteasome 20S beta2 Antibody Summary

Synthetic peptides corresponding to PSMB2(proteasome (prosome, macropain) subunit, beta type, 2) The peptide sequence was selected from the middle region of PSMB2 (NP_002785). Peptide sequence LDRYYTPTISRERAVELLRKCLEELQKRFILNLPTFSVRIIDKNGIHDLD.
This product is specific to Subunit or Isoform: beta type-2.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.2 ug/ml
Application Notes
This is a rabbit polyclonal antibody against PSMB2 and was validated on Western blot.
Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Proteasome 20S beta2 Antibody

  • EC
  • HC7-I
  • Macropain subunit C7-I
  • MGC104215
  • MGC126885
  • multicatalytic endopeptidase complex subunit C7-1
  • Multicatalytic endopeptidase complex subunit C7-I
  • proteasome (prosome, macropain) subunit, beta type, 2
  • proteasome beta 2 subunit
  • Proteasome component C7-I
  • proteasome subunit beta type-2
  • proteasome subunit, beta type, 2


The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. PSMB2 is a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit. The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Mu
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, IHC, IHC-P
Species: Hu, Mu
Applications: WB

Publications for Proteasome 20S beta2 Antibody (NBP1-54590) (0)

There are no publications for Proteasome 20S beta2 Antibody (NBP1-54590).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Proteasome 20S beta2 Antibody (NBP1-54590) (0)

There are no reviews for Proteasome 20S beta2 Antibody (NBP1-54590). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Proteasome 20S beta2 Antibody (NBP1-54590) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for Proteasome 20S beta2 Antibody (NBP1-54590)

Discover related pathways, diseases and genes to Proteasome 20S beta2 Antibody (NBP1-54590). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Proteasome 20S beta2 Antibody (NBP1-54590)

Discover more about diseases related to Proteasome 20S beta2 Antibody (NBP1-54590).

Pathways for Proteasome 20S beta2 Antibody (NBP1-54590)

View related products by pathway.

PTMs for Proteasome 20S beta2 Antibody (NBP1-54590)

Learn more about PTMs related to Proteasome 20S beta2 Antibody (NBP1-54590).

Blogs on Proteasome 20S beta2

There are no specific blogs for Proteasome 20S beta2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Proteasome 20S beta2 Antibody and receive a gift card or discount.


Gene Symbol PSMB2