Proteasome 20S beta 6 Antibody


Western Blot: Proteasome 20S beta 6 Antibody [NBP2-57831] - Analysis in human cell line A-549.
Immunocytochemistry/ Immunofluorescence: Proteasome 20S beta 6 Antibody [NBP2-57831] - Staining of human cell line PC-3 shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF

Order Details

Proteasome 20S beta 6 Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SIELNEPPLVHTAASLFKEMCYRYREDLMAGIIIAGWDPQEGGQVYSVPM
Specificity of human Proteasome 20S beta 6 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Proteasome 20S beta 6 Recombinant Protein Antigen (NBP2-57831PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for Proteasome 20S beta 6 Antibody

  • EC
  • LMPY
  • Macropain delta chain
  • Multicatalytic endopeptidase complex delta chain
  • proteasome (prosome, macropain) subunit, beta type, 6
  • proteasome catalytic subunit 1
  • Proteasome delta chain
  • proteasome subunit beta 6
  • proteasome subunit beta type-6
  • proteasome subunit delta
  • Proteasome subunit Y
  • PSY large multifunctional protease Y
  • YMGC5169


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Pm
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
Species: Hu, Mu, Rt, Al, Av, Bv, Ce, Pl
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP, KD
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, ICC/IF
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Bv(-), Ca(-), Ch(-), Mu(-), Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, RIA
Species: All-NA
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Av, Bv, Ca, Ch, ChHa, Dr, Eq, Fe, Ha, Ma-Op, Pm, Rb, Sh, Ze
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-Fr, IP, KD, Single-Cell Western

Publications for Proteasome 20S beta 6 Antibody (NBP2-57831) (0)

There are no publications for Proteasome 20S beta 6 Antibody (NBP2-57831).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Proteasome 20S beta 6 Antibody (NBP2-57831) (0)

There are no reviews for Proteasome 20S beta 6 Antibody (NBP2-57831). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Proteasome 20S beta 6 Antibody (NBP2-57831) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional Proteasome 20S beta 6 Products

Bioinformatics Tool for Proteasome 20S beta 6 Antibody (NBP2-57831)

Discover related pathways, diseases and genes to Proteasome 20S beta 6 Antibody (NBP2-57831). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Proteasome 20S beta 6 Antibody (NBP2-57831)

Discover more about diseases related to Proteasome 20S beta 6 Antibody (NBP2-57831).

Pathways for Proteasome 20S beta 6 Antibody (NBP2-57831)

View related products by pathway.

PTMs for Proteasome 20S beta 6 Antibody (NBP2-57831)

Learn more about PTMs related to Proteasome 20S beta 6 Antibody (NBP2-57831).

Research Areas for Proteasome 20S beta 6 Antibody (NBP2-57831)

Find related products by research area.

Blogs on Proteasome 20S beta 6

There are no specific blogs for Proteasome 20S beta 6, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Proteasome 20S beta 6 Antibody and receive a gift card or discount.


Gene Symbol PSMB6