Proteasome 20S alpha 6 Antibody

Images

 
Western Blot: Proteasome 20S alpha 6 Antibody [H00005687-B01P] - Analysis of PSMA6 expression in human liver.
Immunocytochemistry/ Immunofluorescence: Proteasome 20S alpha 6 Antibody [H00005687-B01P] - Analysis of purified antibody to PSMA6 on HeLa cell. (antibody concentration 10 ug/ml)
Western Blot: Proteasome 20S alpha 6 Antibody [H00005687-B01P] - Analysis of PSMA6 expression in transfected 293T cell line by PSMA6 polyclonal antibody. Lane 1: PSMA6 transfected lysate(27.06 KDa). Lane 2: ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Proteasome 20S alpha 6 Antibody Summary

Immunogen
PSMA6 (NP_002782.1, 1 a.a. - 246 a.a.) full-length human protein. MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKLLDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDAHLVALAERD
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
PSMA6
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Immunocytochemistry/Immunofluorescence
Application Notes
It has been used for WB and IF.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Proteasome 20S alpha 6 Antibody

  • EC 3.4.25.1
  • IOTA
  • Macropain iota chain
  • macropain subunit iota
  • MGC22756
  • MGC2333
  • MGC23846
  • Multicatalytic endopeptidase complex iota chain
  • P27K
  • p27KPROS-27
  • PROS2727 kDa prosomal protein
  • prosomal P27K protein
  • proteasome (prosome, macropain) subunit, alpha type, 6
  • Proteasome iota chain
  • proteasome subunit alpha type-6
  • proteasome subunit iota

Background

The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the peptidase T1A family, that is a 20S core alpha subunit. A pseudogene has been identified on the Y chromosome.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF7565
Species: Hu, Mu, Rt
Applications: WB, IHC
AF6667
Species: Mu
Applications: WB, IHC
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
NBP1-32387
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1936
Species: Hu
Applications: WB, IP
NB200-540
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-92293
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-15141
Species: Hu
Applications: WB
NBP2-47560
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80616
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00005688-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NBP1-54633
Species: Hu
Applications: WB, IHC
NB100-56561
Species: Hu, Mu, Rt
Applications: WB
NB300-538
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-84745
Species: Hu
Applications: IHC, IHC-P

Publications for Proteasome 20S alpha 6 Antibody (H00005687-B01P) (0)

There are no publications for Proteasome 20S alpha 6 Antibody (H00005687-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Proteasome 20S alpha 6 Antibody (H00005687-B01P) (0)

There are no reviews for Proteasome 20S alpha 6 Antibody (H00005687-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Proteasome 20S alpha 6 Antibody (H00005687-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Proteasome 20S alpha 6 Products

Bioinformatics Tool for Proteasome 20S alpha 6 Antibody (H00005687-B01P)

Discover related pathways, diseases and genes to Proteasome 20S alpha 6 Antibody (H00005687-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Proteasome 20S alpha 6 Antibody (H00005687-B01P)

Discover more about diseases related to Proteasome 20S alpha 6 Antibody (H00005687-B01P).
 

Pathways for Proteasome 20S alpha 6 Antibody (H00005687-B01P)

View related products by pathway.

PTMs for Proteasome 20S alpha 6 Antibody (H00005687-B01P)

Learn more about PTMs related to Proteasome 20S alpha 6 Antibody (H00005687-B01P).

Blogs on Proteasome 20S alpha 6

There are no specific blogs for Proteasome 20S alpha 6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Proteasome 20S alpha 6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PSMA6
Uniprot