Proteasome 20S alpha 5 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: Proteasome 20S alpha 5 Antibody [NBP1-86838] - Staining of human cell line U-251 MG shows localization to cytosol. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: Proteasome 20S alpha 5 Antibody [NBP1-86838] - Staining of human testis shows distinct nuclear and cytoplasmic positivity in seminiferous duct cells.

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG spLane 4: Human plasma (IgG/HSA depleted)Lane 5: Human liver tissueLane 6: Human tonsil tissue

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Proteasome 20S alpha 5 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Proteasome 20S alpha 5 Antibody - BSA Free (NBP1-86838) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-Proteasome 20S alpha 5 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: ARAIGSASEGAQSSLQEVYHKSMTLKEAIKSSLIILKQVMEEKLNATNIELATVQPGQNFHMFTKEELEEVIKDI
• Predicted Species: Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PSMA5
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF fixation permeabilization: PFA/Triton X-100.
• Control Peptide:

  Proteasome 20S alpha 5 Protein (NBP1-86838PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Proteasome 20S alpha 5 Antibody - BSA Free

• EC 3.4.25.1
• FLJ42315
• macropain subunit zeta
• Macropain zeta chain
• MGC117302
• MGC125802
• MGC125803
• MGC125804
• Multicatalytic endopeptidase complex zeta chain
• proteasome (prosome, macropain) subunit, alpha type, 5
• Proteasome 20S alpha 5
• proteasome alpha 5 subunit
• proteasome component 5
• proteasome subunit alpha type-5
• proteasome subunit zeta
• Proteasome zeta chain
• PSC5
• PSMA5
• ZETA

Background

Proteolytic degradation is critical to the maintenance of appropriate levels of short-lived and regulatory proteins as important and diverse as those involved in cellular metabolism, heat shock and stress response, antigen presentation, modulation of cell surface receptors and ion channels, cell cycle regulation, transcription, and signaling factors. The ubiquitin-proteasome pathway deconstructs most proteins in the eukaryotic cell cytosol and nucleus. Others are degraded via the vacuolar pathway which includes endosomes, lysosomes, and the endoplasmic reticulum. The 26S proteasome is an ATP-dependent, multisubunit (~31), barrel-shaped molecular machine with an apparent molecular weight of ~2.5 MDa. It consists of a 20S proteolytic core complex which is crowned at one or both ends by 19S regulatory subunit complexes. The 19S regulatory subunits recognize ubiquitinated proteins and play an essential role in unfolding and translocating targets into the lumen of the 20S subunit. An enzymatic cascade is responsible for the attachment of multiple ubiquitin molecules to lysine residues of proteins targeted for degradation. Several genetic diseases are associated with defects in the ubiquitin-proteasome pathway. Some examples of affected proteins include those linked to cystic fibrosis, Angelman's syndrome, and Liddle syndrome.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Proteasome 20S alpha 5 Antibody (NBP1-86838)(1)

Publication using NBP1-86838

• Carrettiero DC, Almeida MC, Longhini AP et al. Stress routes clients to the proteasome via a BAG2 ubiquitin-independent degradation condensate Nature communications 2022-06-02 [PMID: 35654899] (ICC/IF, Human)

Bioinformatics

• Gene Symbol: PSMA5